DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and ctdnep1a

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001007310.1 Gene:ctdnep1a / 492343 ZFINID:ZDB-GENE-041114-177 Length:245 Species:Danio rerio


Alignment Length:226 Identity:65/226 - (28%)
Similarity:99/226 - (43%) Gaps:39/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RMWKSIHYYQR-----MIQ-EPSRAKLLP-DPLKPPYVQ--PRYTLVLEMKDVLVH--------- 241
            |:|....|..|     :|| :..|..:|| .|:....:.  .|..|||::.:.|:|         
Zfish    20 RIWSFFLYILRKHLRTIIQYQTVRYDILPLSPISRNRLNAVKRKILVLDLDETLIHSHHDGVLRP 84

  Fly   242 -------PDWTYQT-----GWRF--KKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPN 292
                   ||:..:.     ..||  .|||.||.||...::.:|:|||||...:....:.|.||.|
Zfish    85 TVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNN 149

  Fly   293 -GYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQ 356
             |.:..|..|.......|.::|:|..::.||..::::|....|.:.||||...:..|..:..|..
Zfish   150 RGILKRRYYRQHCTLDLGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTA 214

  Fly   357 LLDLIAFLKIIAQNNVDDVREV----LHYYR 383
            ||:|:..|.  |.....|||.|    ||.:|
Zfish   215 LLNLLPMLD--ALRFTSDVRSVLSRNLHQHR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 42/151 (28%)
ctdnep1aNP_001007310.1 HIF-SF_euk 62..230 CDD:274055 48/169 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.