DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and CG12078

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_647795.2 Gene:CG12078 / 38401 FlyBaseID:FBgn0035426 Length:253 Species:Drosophila melanogaster


Alignment Length:226 Identity:58/226 - (25%)
Similarity:97/226 - (42%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 LQRMWKSIHYYQRMIQE--P----SRAKLLPDPLKPPYVQPRYTLVLEMKDVLVHPDWTYQTGWR 251
            :.|:|..:....|:..|  |    |..:|.|.......:..|.||||:|.:.:: ..|..:.|.:
  Fly    29 IPRLWFFLEKVYRVFVEYTPIIYLSEDRLSPVSKSRLSLVARKTLVLDMDNTMI-TSWFIKRGKK 92

  Fly   252 ----------FK-------------KRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALD-PN 292
                      ||             |||.:||||...:|.:::.|||:...:...||||.|| ..
  Fly    93 PKNIPRIAHDFKFYLPAYGATIYVYKRPYLDHFLDRVSKWYDLTVFTSGAEIYASPILDFLDRGR 157

  Fly   293 GYIMYRLVRDATHFVD--GHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDG 355
            |.:..||.|.  |.::  |...|::.....||..|:::|..:.....:.:|...:..:.....|.
  Fly   158 GILNSRLYRQ--HCIEQFGKWSKSVLLACPDLSNVVLLDNSSTECSFNAENAILIKSYEIGCRDE 220

  Fly   356 QLLDLIAFLKIIAQNNVDDVREVLHYYRQFD 386
            .|::|:.||.  |...:.|||.:|....:|:
  Fly   221 ALINLLPFLD--ALRFMKDVRSMLKRCTRFE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 39/153 (25%)
CG12078NP_647795.2 HIF-SF_euk 70..237 CDD:274055 45/171 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461632
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.