DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and Ctdsp1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001121551.1 Gene:Ctdsp1 / 363249 RGDID:1305629 Length:261 Species:Rattus norvegicus


Alignment Length:191 Identity:59/191 - (30%)
Similarity:89/191 - (46%) Gaps:25/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 LPDPLKPPYVQP--------RYTLVLEMKDVLVHPDWTYQTGWRF---------------KKRPG 257
            :|......|:.|        :..:|:::.:.|||..:.......|               .|||.
  Rat    70 IPKHTPVQYLLPEVKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPH 134

  Fly   258 VDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDL 322
            ||.||....:.||.|:|||.......|:.|.||..|....||.|::..|..|::||:|..|.|||
  Rat   135 VDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDL 199

  Fly   323 KKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYR 383
            ::|:::|....:...||||...:|.|..|..|.:|.||:.|.:.:::  ||||..||...|
  Rat   200 RRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSR--VDDVYSVLRQPR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 45/150 (30%)
Ctdsp1NP_001121551.1 HIF-SF_euk 90..249 CDD:274055 50/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.