DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and CG8584

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster


Alignment Length:234 Identity:57/234 - (24%)
Similarity:93/234 - (39%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYTLVLEMKDVLVH----------- 241
            :::.||...::.:...|.|....:             |..|.||||::.:.|||           
  Fly    68 ILRTYLGLSYREVSVSQDMAHRLA-------------VVGRKTLVLDLDETLVHSCYLDPDTHDN 119

  Fly   242 -----------PDWTYQTG--------WRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILD 287
                       ||:.....        :|..|||.||.||...:|.:::|::||...:....::|
  Fly   120 VGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVD 184

  Fly   288 ALDP-NGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGN 351
            .||. .|.|..|..|...........|:|..:..|:..|:::|....|.:..|||...:..:..:
  Fly   185 HLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYD 249

  Fly   352 DDDGQLLDLIAFLKIIAQNNVDDVREVL------HYYRQ 384
            .||.:||.::.||.  |.....|||.:|      |||.:
  Fly   250 PDDTELLKMLPFLD--ALRFTKDVRSILGRRVIRHYYNR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 39/158 (25%)
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 45/176 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461634
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.