DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and Dd

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_608449.1 Gene:Dd / 33107 FlyBaseID:FBgn0029067 Length:243 Species:Drosophila melanogaster


Alignment Length:232 Identity:65/232 - (28%)
Similarity:102/232 - (43%) Gaps:47/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 LQRMWKSIHY-YQRMIQ-----EPSRAKLLPDPLKP------PYVQPRYTLVLEMKDVLVH---- 241
            |.::|..|.: :.|.::     :|.:.:|.  ||.|      ..|| |.||||::.:.|:|    
  Fly    16 LSKVWTCICFMFNRQVRAFIQYQPVKYELF--PLSPVSRHRLSLVQ-RKTLVLDLDETLIHSHHN 77

  Fly   242 --PDWTYQTGW---------------RF--KKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILD 287
              |..|.:.|.               ||  .|||.||:||...::.:::|||||...:....:.|
  Fly    78 AMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVAD 142

  Fly   288 ALDPNGYIMYRLVRDATHFVD--GHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHG 350
            .|| ||..:.|......|...  |.:.|:|..:..||.::.::|....|.:..|:|...:..|..
  Fly   143 KLD-NGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFS 206

  Fly   351 NDDDGQLLDLIAFLKIIAQNNVDDVREV----LHYYR 383
            :..|..||.|:..|..:...|  |||.|    ||.:|
  Fly   207 DPMDTALLSLLPMLDALRFTN--DVRSVLSRNLHLHR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 41/152 (27%)
DdNP_608449.1 HIF-SF_euk 60..228 CDD:274055 47/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461633
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.