DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and Ctdspl

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001382669.1 Gene:Ctdspl / 301056 RGDID:1304841 Length:276 Species:Rattus norvegicus


Alignment Length:287 Identity:76/287 - (26%)
Similarity:127/287 - (44%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SNAEQERKKREEEEEKENER--AWKRMKLGFAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEF 183
            :|.:::..:.....||.::|  :.|:.:       |.::.:.|:..:.....|..|...|    .
  Rat    11 TNPKEDEARSPVAGEKASQRNISLKKQR-------GRSILSSFFCCFRDYNVEPPPPSSP----S 64

  Fly   184 THKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPP--YVQPRYT--------LVLEMKDV 238
            ...|||::            ...:|:..:.:::|.| .||  |:.|..|        :|:::.:.
  Rat    65 VLPPLVEE------------NGGLQKGDQRQVIPVP-SPPAKYLLPEVTVLDHGKKCVVIDLDET 116

  Fly   239 LVHPDWTYQTGWRF---------------KKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDA 288
            |||..:...:...|               .|||.||.||....:.||.|:|||.......|:.|.
  Rat   117 LVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADL 181

  Fly   289 LDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDD 353
            ||..|....||.|::..|..|::||:|..|.|:|.|||:||....:...||:|...:..|..:..
  Rat   182 LDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMT 246

  Fly   354 DGQLLDLIAFLKIIAQNNVDDVREVLH 380
            |.:|||||.|.:.:::.  |||..:||
  Rat   247 DTELLDLIPFFEGLSRE--DDVYRMLH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 45/150 (30%)
CtdsplNP_001382669.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.