DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and Ctdnep1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_017452582.2 Gene:Ctdnep1 / 287447 RGDID:1310172 Length:285 Species:Rattus norvegicus


Alignment Length:208 Identity:55/208 - (26%)
Similarity:94/208 - (45%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 QRMW-KSIHYYQRMIQ-EPSRAKLLP-DPLKPPYVQ--PRYTLVLEMKDVLVH------------ 241
            :.:| .|:..:.::|| :..|..:|| .||....:.  .|..|||::.:.|:|            
  Rat    54 KHLWVLSLKLFSKVIQYQTVRYDILPLSPLSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVR 118

  Fly   242 ----PDWTYQT-----GWRF--KKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYI 295
                ||:..:.     ..||  .|||.||.||...::.:|:|||||...:....:.|.||.:..|
  Rat   119 PGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSI 183

  Fly   296 M-YRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHP----DNTFGLARWHGNDDDG 355
            : .|..|.......|.::|:|..::.||..::::|....|.:.||    ||...:..|..:..|.
  Rat   184 LKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPGMGKDNAIPIKSWFSDPSDT 248

  Fly   356 QLLDLIAFLKIIA 368
            .||:|:..|..::
  Rat   249 ALLNLLPMLDALS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 41/155 (26%)
Ctdnep1XP_017452582.2 HIF-SF_euk 93..263 CDD:274055 46/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.