DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and cnep-1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001254123.1 Gene:cnep-1 / 185802 WormBaseID:WBGene00018474 Length:276 Species:Caenorhabditis elegans


Alignment Length:176 Identity:48/176 - (27%)
Similarity:78/176 - (44%) Gaps:26/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RYTLVLEMKDVLVH----------------PDWT-------YQTGWRFKKRPGVDHFLAECAKDF 269
            |..|||::.:.|:|                .|:|       :...:...:||.||:||:..::.:
 Worm    87 RKILVLDLDETLIHSHHDGVLRQTVKPGTPSDFTIRVVIDRHPVKFSVHERPHVDYFLSVVSQWY 151

  Fly   270 EIVVFTAEQGMTVFPILDALD-PNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDAN 333
            |:|||||...:....:.|.|| ..|.:..|..|.......|.:.|:|..::.||..:.::|....
 Worm   152 ELVVFTASMEVYGTSVADRLDRGRGILKRRYFRQHCTMEVGGYTKDLSAIHPDLSSICILDNSPG 216

  Fly   334 ATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVL 379
            |.:..|.|...:..|..:.:|..||:|:.||.  |.....|||.||
 Worm   217 AYRKFPHNAIPIPSWFSDPNDTCLLNLLPFLD--ALRFTSDVRSVL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 36/150 (24%)
cnep-1NP_001254123.1 HIF-SF_euk 87..255 CDD:274055 43/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.