DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and UBLCP1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_659486.2 Gene:UBLCP1 / 134510 HGNCID:28110 Length:318 Species:Homo sapiens


Alignment Length:240 Identity:55/240 - (22%)
Similarity:92/240 - (38%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PEVDP--NGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYTLV 232
            |:.|.  |...||||.......::.|.::.:.:..|:..|..|.|             :.:..||
Human    90 PDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPR-------------EGKKLLV 141

  Fly   233 LEMKDVLVHPDWTYQTGWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMY 297
            |::...|.......:||... .||.:..||....:|::||:::|.....:...:..|..:....|
Human   142 LDVDYTLFDHRSCAETGVEL-MRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANY 205

  Fly   298 RLVRDATHFVDGHHVKNLDNLNRDL-------------------KKVIVVDWDANATKMHPDNTF 343
            ::    |..:|...:..:....|.|                   |..|:.|.......|:|.|  
Human   206 KI----TFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQN-- 264

  Fly   344 GL-----ARWHGN-DDDGQLLDLIAFLKIIAQNNVDDVREVLHYY 382
            ||     .:.|.| |.|.:||.|..:||.||:  :||..::.|.|
Human   265 GLKIRPFMKAHLNRDKDKELLKLTQYLKEIAK--LDDFLDLNHKY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 31/152 (20%)
UBLCP1NP_659486.2 Ubl_UBLCP1 3..77 CDD:340511
HAD_IIID1 117..311 CDD:131299 47/213 (22%)
Phosphatase 133..294 38/180 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.