DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and ctdspl

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_031759361.1 Gene:ctdspl / 100487887 XenbaseID:XB-GENE-1013061 Length:276 Species:Xenopus tropicalis


Alignment Length:249 Identity:68/249 - (27%)
Similarity:106/249 - (42%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 YEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPP--YVQP 227
            |....|..:.|..|:      .|||::            ...||:..:.:.|..| .||  |:.|
 Frog    52 YSVEPPTSNNNSSPL------PPLVEE------------NGGIQKADQTQALTIP-SPPAKYLLP 97

  Fly   228 --------RYTLVLEMKDVLVHPDWTYQTGWRFK-----------------------KRPGVDHF 261
                    :..:|:::.:.|||..        ||                       |||.||.|
 Frog    98 ELKVSDYGKKCVVIDLDETLVHSS--------FKPINNADFIVPVEIDGTIHQVYVLKRPHVDEF 154

  Fly   262 LAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVI 326
            |.:..:.||.|:|||.......|:.|.||..|....||.|::..|..|::||:|..|.|:|.|||
 Frog   155 LQKMGELFECVLFTASLAKYADPVADLLDRWGVFNARLFRESCVFHRGNYVKDLSRLGRELSKVI 219

  Fly   327 VVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLH 380
            ::|....:...||:|...:..|..:..|.:|||||.|.:.:::.  |:|..:|:
 Frog   220 IIDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSKE--DNVYNMLN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 44/158 (28%)
ctdsplXP_031759361.1 HIF-SF_euk 106..264 CDD:274055 50/167 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.