DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and DOT5

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_172787.1 Gene:DOT5 / 837889 AraportID:AT1G13290 Length:302 Species:Arabidopsis thaliana


Alignment Length:302 Identity:63/302 - (20%)
Similarity:103/302 - (34%) Gaps:76/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 HQLAQSGDQQEEHITMESVHEFQPAEVEYVTIKNEFETIVTEEDEFE--VMNDSGAHDAILDCQM 245
            :|.:.|||:....:::      .|...:|.:......|..:.:.||.  :.|.:|...|:    .
plant     5 NQYSFSGDEDSVVLSL------GPPGQQYPSHNKPTSTKPSSDHEFNHPLTNPNGVTVAL----H 59

  Fly   246 IVIPAEGAIDEVIGEETLELEGDGRE-------EHLLPEAEDVCEDEDFLEESLDSAPPTAGEAL 303
            |..|:.       .:|||. .|:.:|       ::.:|....:.            ..||     
plant    60 IGPPSS-------DKETLS-GGNNQEGLTARQGQYWIPSLSQIL------------VGPT----- 99

  Fly   304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
            .:.|:||.|.|.:...:..||..|  ..||.     |..:.||..|    :.:::....|..|..
plant   100 QFSCSVCNKTFNRFNNMQMHMWGH--GSQYR-----KGPESLRGTK----SSSSILRLPCYCCAE 153

  Fly   369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYAC-DLCDKAYYDSSSL 432
            ..:....       |...||..         .|..|:.|.....|.:|:.| ..|:|.:......
plant   154 GCKNNID-------HPRSKPLK---------DFRTLQTHYKRKHGAKPFRCRKKCEKTFAVRGDW 202

  Fly   433 RQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVH-SGVKAH 473
            |.|: .:.||..| | :||.....|...|.|:... .|..||
plant   203 RTHE-KNCGKLWF-C-VCGSDFKHKRSLKDHVRAFGDGHAAH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 35/154 (23%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 4/19 (21%)
C2H2 Zn finger 363..383 CDD:275368 2/19 (11%)
COG5048 <387..523 CDD:227381 24/89 (27%)
C2H2 Zn finger 391..411 CDD:275368 3/19 (16%)
zf-H2C2_2 403..426 CDD:290200 7/23 (30%)
C2H2 Zn finger 419..439 CDD:275368 5/20 (25%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368
zf-H2C2_2 487..510 CDD:290200
C2H2 Zn finger 503..523 CDD:275368
DOT5NP_172787.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.