DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dwg and AT2G28710

DIOPT Version :9

Sequence 1:	NP_477338.3	Gene:	dwg / 31265	FlyBaseID:	FBgn0000520	Length:	592	Species:	Drosophila melanogaster
Sequence 2:	NP_180439.1	Gene:	AT2G28710 / 817420	AraportID:	AT2G28710	Length:	156	Species:	Arabidopsis thaliana

Alignment Length:	135	Identity:	35/135 - (25%)
Similarity:	48/135 - (35%)	Gaps:	52/135 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly   471 KAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAV 535
            |||:.|                   :..:.|.|:.|.|.||:.:.|..|...|.:      :.|:
plant    23 KAHQND-------------------TKSRVFACKTCNKEFPSFQALGGHRASHRR------SAAL 62

  Fly   536 QSINPPSRQ-----------AGAEGATG---GG----ATGGSPTGGGATGGSATNLHITEVHEQP 582
            :...|||.:           .|||.|.|   ||    ..|||..|||.:...||         .|
plant    63 EGHAPPSPKRVKPVKHECPICGAEFAVGQALGGHMRKHRGGSGGGGGRSLAPAT---------AP 118

  Fly   583 VSTSK 587
            |:..|
plant   119 VTMKK 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dwg	NP_477338.3	zf-AD	14..91	CDD:214871
		COG5048	<297..451	CDD:227381
		C2H2 Zn finger	307..327	CDD:275368
		C2H2 Zn finger	335..355	CDD:275368
		C2H2 Zn finger	363..383	CDD:275368
		COG5048	<387..523	CDD:227381	12/51 (24%)
		C2H2 Zn finger	391..411	CDD:275368
		zf-H2C2_2	403..426	CDD:290200
		C2H2 Zn finger	419..439	CDD:275368
		C2H2 Zn finger	447..467	CDD:275368
		C2H2 Zn finger	475..495	CDD:275368	1/19 (5%)
		zf-H2C2_2	487..510	CDD:290200	4/22 (18%)
		C2H2 Zn finger	503..523	CDD:275368	7/19 (37%)
AT2G28710	NP_180439.1	zf-C2H2_6	33..59	CDD:404748	9/31 (29%)
AT2G28710	NP_180439.1	zf-C2H2_6	78..100	CDD:404748	7/21 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910