| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001077868.1 | Gene: | SGR5 / 814725 | AraportID: | AT2G01940 | Length: | 446 | Species: | Arabidopsis thaliana |
| Alignment Length: | 195 | Identity: | 51/195 - (26%) |
|---|---|---|---|
| Similarity: | 79/195 - (40%) | Gaps: | 36/195 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 363 CSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYAC-------- 419
Fly 420 DLCDKAYYDSSSLRQH-KISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFT 483
Fly 484 F--------TSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSINP 540
Fly 541 540 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 22/96 (23%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | |||
| C2H2 Zn finger | 335..355 | CDD:275368 | |||
| C2H2 Zn finger | 363..383 | CDD:275368 | 6/19 (32%) | ||
| COG5048 | <387..523 | CDD:227381 | 37/152 (24%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 6/30 (20%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 5/28 (18%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 8/27 (30%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 503..523 | CDD:275368 | 4/19 (21%) | ||
| SGR5 | NP_001077868.1 | C2H2 Zn finger | 75..95 | CDD:275368 | 6/19 (32%) |
| C2H2 Zn finger | 117..145 | CDD:275368 | 5/28 (18%) | ||
| C2H2 Zn finger | 153..172 | CDD:275368 | 8/18 (44%) | ||
| ATP-synt_B | <332..422 | CDD:304375 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||