Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350037.1 | Gene: | ZBTB3 / 79842 | HGNCID: | 22918 | Length: | 524 | Species: | Homo sapiens |
Alignment Length: | 254 | Identity: | 58/254 - (22%) |
---|---|---|---|
Similarity: | 79/254 - (31%) | Gaps: | 105/254 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 206 PAEVEYVTIKNEFETIVTEEDEFEVMND--SGAHDAILDCQMIVIPAEGAIDEVIGEETLELEGD 268
Fly 269 GREEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQY 333
Fly 334 ECEECGKRLKHLRNYKEHML-THTNVKPHQCSICGRFYR--TTSSLAVHKRTH------------ 383
Fly 384 -------AEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQH 435 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 36/161 (22%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 0/19 (0%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 5/21 (24%) | ||
COG5048 | <387..523 | CDD:227381 | 20/49 (41%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 6/17 (35%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | |||
C2H2 Zn finger | 475..495 | CDD:275368 | |||
zf-H2C2_2 | 487..510 | CDD:290200 | |||
C2H2 Zn finger | 503..523 | CDD:275368 | |||
ZBTB3 | NP_001350037.1 | BTB_POZ_ZBTB3 | 1..130 | CDD:349632 | |
PHA03247 | <173..401 | CDD:223021 | 37/184 (20%) | ||
C2H2 Zn finger | 424..444 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 437..461 | CDD:372612 | 13/23 (57%) | ||
C2H2 Zn finger | 452..470 | CDD:275368 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |