DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZBTB3

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001350037.1 Gene:ZBTB3 / 79842 HGNCID:22918 Length:524 Species:Homo sapiens


Alignment Length:254 Identity:58/254 - (22%)
Similarity:79/254 - (31%) Gaps:105/254 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PAEVEYVTIKNEFETIVTEEDEFEVMND--SGAHDAILDCQMIVIPAEGAIDEVIGEETLELEGD 268
            |||.|.|.:|  .|.||..::|.:|.::  .|...|        .|:.||   |.|.:       
Human   296 PAEAELVQVK--VEAIVISDEETDVSDEQPQGPERA--------FPSGGA---VYGAQ------- 340

  Fly   269 GREEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQY 333
                   |...:..||           |..||                                 
Human   341 -------PSQPEAFED-----------PGAAG--------------------------------- 354

  Fly   334 ECEECGKRLKHLRNYKEHML-THTNVKPHQCSICGRFYR--TTSSLAVHKRTH------------ 383
             .||.|.        .:|.| |..::..|.....|:::|  .||.|......|            
Human   355 -LEEVGP--------SDHFLPTDPHLPYHLLPGAGQYHRGLVTSPLPAPASLHEPLYLSSEYEAA 410

  Fly   384 -------AEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQH 435
                   .|..| .|..||:.::....||||...||.||||.|..|.::|..|..|.:|
Human   411 PGSFGVFTEDVP-TCKTCGKTFSCSYTLRRHATVHTRERPYECRYCLRSYTQSGDLYRH 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 36/161 (22%)
C2H2 Zn finger 307..327 CDD:275368 0/19 (0%)
C2H2 Zn finger 335..355 CDD:275368 5/20 (25%)
C2H2 Zn finger 363..383 CDD:275368 5/21 (24%)
COG5048 <387..523 CDD:227381 20/49 (41%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 12/22 (55%)
C2H2 Zn finger 419..439 CDD:275368 6/17 (35%)
C2H2 Zn finger 447..467 CDD:275368
C2H2 Zn finger 475..495 CDD:275368
zf-H2C2_2 487..510 CDD:290200
C2H2 Zn finger 503..523 CDD:275368
ZBTB3NP_001350037.1 BTB_POZ_ZBTB3 1..130 CDD:349632
PHA03247 <173..401 CDD:223021 37/184 (20%)
C2H2 Zn finger 424..444 CDD:275368 7/19 (37%)
zf-H2C2_2 437..461 CDD:372612 13/23 (57%)
C2H2 Zn finger 452..470 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.