| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_079038.2 | Gene: | ZNF552 / 79818 | HGNCID: | 26135 | Length: | 407 | Species: | Homo sapiens |
| Alignment Length: | 294 | Identity: | 90/294 - (30%) |
|---|---|---|---|
| Similarity: | 132/294 - (44%) | Gaps: | 50/294 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 249 PAEGAIDEVIGEETLELEGDGREEHLLPEAEDVCEDEDFL-------EESLDSAPPTA------- 299
Fly 300 --GEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQ 362
Fly 363 CSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYY 427
Fly 428 DSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHV 492
Fly 493 RLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKE 526 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 53/162 (33%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 9/19 (47%) | ||
| COG5048 | <387..523 | CDD:227381 | 47/135 (35%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 13/22 (59%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 0/19 (0%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 503..523 | CDD:275368 | 7/19 (37%) | ||
| ZNF552 | NP_079038.2 | KRAB | 14..>55 | CDD:214630 | |
| KRAB | 14..53 | CDD:279668 | |||
| C2H2 Zn finger | 93..113 | CDD:275368 | |||
| C2H2 Zn finger | 121..141 | CDD:275368 | |||
| C2H2 Zn finger | 214..234 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | <243..407 | CDD:227381 | 68/191 (36%) | ||
| C2H2 Zn finger | 244..262 | CDD:275368 | 5/17 (29%) | ||
| C2H2 Zn finger | 270..290 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 282..307 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 298..318 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 310..335 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 326..346 | CDD:275368 | 8/47 (17%) | ||
| zf-H2C2_2 | 339..362 | CDD:290200 | 10/50 (20%) | ||
| C2H2 Zn finger | 354..374 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 382..402 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||