DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF76

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_011513148.1 Gene:ZNF76 / 7629 HGNCID:13149 Length:591 Species:Homo sapiens


Alignment Length:396 Identity:114/396 - (28%)
Similarity:167/396 - (42%) Gaps:82/396 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DAILDCQMIVIPAEGAIDEVIGEETLELEG----DGR----EE------HLLPEAEDVCEDEDFL 288
            :.:|:.|  ||..|......|.:.|::.|.    ||:    |:      |..|.....|.    |
Human    26 EKLLEGQ--VIQLEDGTTAYIHQVTVQKEALSFEDGQPVQLEDGSMAYIHRTPRGLTACS----L 84

  Fly   289 EESLDSAP--PTAGE--ALPYVCT--VCQK-----AFRQ-------QCRLNQHMRSHVDEKQYEC 335
            ::::..||  |:..:  .||...|  :|.:     .:||       |.|:   ||:.|..:.:..
Human    85 QKAMTPAPWKPSNWKMAPLPTFTTLWLCHRRAPSWPYRQRWAWRTWQQRM---MRASVQTQWWPW 146

  Fly   336 EECGKRL--------KHLRNYKEHMLTHTNVKPHQCSI--CGRFYRTTSSLAVHKRTHAEKKPYN 390
            .....||        :..||.|...:   ..:..:|..  |||.|.|...|.||:|.|...:||.
Human   147 SSMPARLFPQVLHDSQIPRNGKGQQV---GDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYR 208

  Fly   391 CD--QCGRGYAAFDHLRRHKLTHTGERPYAC--DLCDKAYYDSSSLRQHKISHTGKKAFTC--EI 449
            ||  .||:.:|....|:.|..|||||:||.|  :||.||:..|..|::|..:|||::.|.|  |.
Human   209 CDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEG 273

  Fly   450 CGVGLSQKSGYKKHMMVHSGVKAHKCDV--CGHAFTFTSNLNAHVRLHSGEKPFKCEV--CVKAF 510
            ||...:..:..|.|:..|:|.:.:.|..  ||..||..:|...|||:|:||||:.|.|  |.|.|
Human   274 CGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRF 338

  Fly   511 PTKKRLASHMRVHNKESPVTATVAVQSINPPSRQAGAEGATGGGATGGSPTGGGATGGSATNLHI 575
            .....|..|..||....|.|.:...::....|..|..:.:..|                  .|..
Human   339 TEYSSLYKHHVVHTHCKPYTCSTCGKTYRQTSTLAMHKRSAHG------------------ELEA 385

  Fly   576 TEVHEQ 581
            ||..||
Human   386 TEESEQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 58/185 (31%)
C2H2 Zn finger 307..327 CDD:275368 8/33 (24%)
C2H2 Zn finger 335..355 CDD:275368 5/27 (19%)
C2H2 Zn finger 363..383 CDD:275368 10/21 (48%)
COG5048 <387..523 CDD:227381 57/145 (39%)
C2H2 Zn finger 391..411 CDD:275368 7/21 (33%)
zf-H2C2_2 403..426 CDD:290200 13/24 (54%)
C2H2 Zn finger 419..439 CDD:275368 8/21 (38%)
C2H2 Zn finger 447..467 CDD:275368 6/21 (29%)
C2H2 Zn finger 475..495 CDD:275368 9/21 (43%)
zf-H2C2_2 487..510 CDD:290200 13/24 (54%)
C2H2 Zn finger 503..523 CDD:275368 7/21 (33%)
ZNF76XP_011513148.1 C2H2 Zn finger 179..201 CDD:275368 10/21 (48%)
zf-H2C2_2 193..220 CDD:290200 11/26 (42%)
COG5048 204..>262 CDD:227381 24/57 (42%)
C2H2 Zn finger 209..231 CDD:275368 7/21 (33%)
zf-H2C2_2 224..250 CDD:290200 14/25 (56%)
zf-C2H2_aberr 237..358 CDD:293622 45/120 (38%)
C2H2 Zn finger 239..261 CDD:275368 8/21 (38%)
zf-H2C2_2 253..280 CDD:290200 10/26 (38%)
C2H2 Zn finger 269..291 CDD:275368 6/21 (29%)
zf-H2C2_2 285..310 CDD:290200 8/24 (33%)
C2H2 Zn finger 299..321 CDD:275368 9/21 (43%)
zf-H2C2_2 313..339 CDD:290200 13/25 (52%)
C2H2 Zn finger 329..351 CDD:275368 7/21 (33%)
C2H2 Zn finger 359..377 CDD:275368 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.