Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005259261.1 | Gene: | MZF1 / 7593 | HGNCID: | 13108 | Length: | 775 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 82/235 - (34%) |
---|---|---|---|
Similarity: | 132/235 - (56%) | Gaps: | 1/235 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 295 APPTAGEAL-PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNV 358
Fly 359 KPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCD 423
Fly 424 KAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNL 488
Fly 489 NAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 49/154 (32%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 8/19 (42%) | ||
COG5048 | <387..523 | CDD:227381 | 49/135 (36%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 8/19 (42%) | ||
MZF1 | XP_005259261.1 | SCAN | 81..193 | CDD:128708 | |
COG5048 | 399..757 | CDD:227381 | 82/235 (35%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | |||
C2H2 Zn finger | 427..447 | CDD:275368 | |||
C2H2 Zn finger | 455..475 | CDD:275368 | |||
C2H2 Zn finger | 483..503 | CDD:275370 | |||
C2H2 Zn finger | 528..548 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 556..576 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 584..604 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 612..632 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 640..660 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 668..688 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 696..716 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 724..744 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 752..772 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24384 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.970 |