DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF19

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_008892.2 Gene:ZNF19 / 7567 HGNCID:12981 Length:458 Species:Homo sapiens


Alignment Length:292 Identity:100/292 - (34%)
Similarity:147/292 - (50%) Gaps:17/292 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IPAEGAIDEVIGEETLELEGDGREEH----------LLPEAEDVCEDEDF--LEESLDSAPPTAG 300
            |.:|..:.:.|.||.     ||...|          ..||..:|.:.:|.  ::......|....
Human    97 IDSESTLIQGISEER-----DGMMSHGQLKSVPQRTDFPETRNVEKHQDIPTVKNIQGKVPRIPC 156

  Fly   301 EALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSI 365
            ...|::|..|.|:|.......:|.|.|..||.:||.||||......:...|...||..:|:||..
Human   157 ARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECGKAFNGNSSLIRHQRIHTGERPYQCEE 221

  Fly   366 CGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSS 430
            |||.:...::|..|:|.|:..:||.|.:||..:.:......|:..||||:||.|:.|.||:..:|
Human   222 CGRAFNDNANLIRHQRIHSGDRPYYCTECGNSFTSSSEFVIHQRIHTGEKPYECNECGKAFVGNS 286

  Fly   431 SLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLH 495
            .|.:|:..|||:|.:.|..||....:.|...:|..:|:|.|.:.|.|||.||.|.:.|..|.|:|
Human   287 PLLRHQKIHTGEKPYECNECGKSFGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRIH 351

  Fly   496 SGEKPFKCEVCVKAFPTKKRLASHMRVHNKES 527
            |.||||.|..|.|||..:::|..|:|:|.:||
Human   352 SEEKPFDCVDCGKAFSAQEQLKRHLRIHTQES 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 53/153 (35%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
COG5048 <387..523 CDD:227381 55/135 (41%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 5/19 (26%)
C2H2 Zn finger 475..495 CDD:275368 10/19 (53%)
zf-H2C2_2 487..510 CDD:290200 12/22 (55%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
ZNF19NP_008892.2 KRAB 14..73 CDD:214630
KRAB 14..53 CDD:279668
COG5048 <96..426 CDD:227381 100/292 (34%)
C2H2 Zn finger 163..183 CDD:275368 6/19 (32%)
zf-H2C2_2 178..199 CDD:290200 11/20 (55%)
C2H2 Zn finger 191..211 CDD:275368 6/19 (32%)
zf-H2C2_2 203..227 CDD:290200 9/23 (39%)
C2H2 Zn finger 219..239 CDD:275368 7/19 (37%)
zf-H2C2_2 231..256 CDD:290200 9/24 (38%)
C2H2 Zn finger 247..267 CDD:275368 4/19 (21%)
zf-H2C2_2 263..283 CDD:290200 11/19 (58%)
C2H2 Zn finger 275..295 CDD:275368 7/19 (37%)
zf-H2C2_2 288..312 CDD:290200 9/23 (39%)
C2H2 Zn finger 303..323 CDD:275368 5/19 (26%)
zf-H2C2_2 315..339 CDD:290200 9/23 (39%)
C2H2 Zn finger 331..351 CDD:275368 10/19 (53%)
zf-H2C2_2 344..367 CDD:290200 13/22 (59%)
C2H2 Zn finger 359..379 CDD:275368 8/19 (42%)
zf-H2C2_2 372..393 CDD:290200 6/12 (50%)
C2H2 Zn finger 387..407 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.