| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001346384.1 | Gene: | Zup1 / 72580 | MGIID: | 1919830 | Length: | 577 | Species: | Mus musculus |
| Alignment Length: | 203 | Identity: | 40/203 - (19%) |
|---|---|---|---|
| Similarity: | 77/203 - (37%) | Gaps: | 33/203 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 294 SAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNV 358
Fly 359 KPHQCSICGRFYRTTSSLAVHKRT-HAE--KKP--------YNCDQCGRGYAAFDHLRRHKLTHT 412
Fly 413 GERPY-------AC----DLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMV 466
Fly 467 HSGVKAHK 474 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 32/175 (18%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 1/19 (5%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 5/20 (25%) | ||
| COG5048 | <387..523 | CDD:227381 | 20/107 (19%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 6/33 (18%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 3/23 (13%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 40/203 (20%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | |||
| C2H2 Zn finger | 503..523 | CDD:275368 | |||
| Zup1 | NP_001346384.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 124..145 | 2/23 (9%) | |
| MIU. /evidence=ECO:0000250|UniProtKB:Q96AP4 | 225..247 | 2/21 (10%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 238..260 | 2/21 (10%) | |||
| zUBD/ZHA. /evidence=ECO:0000250|UniProtKB:Q96AP4 | 248..273 | 4/24 (17%) | |||
| Peptidase_C78 | 335..550 | CDD:400318 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167839969 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||