DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and RREB1

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001003699.1 Gene:RREB1 / 6239 HGNCID:10449 Length:1742 Species:Homo sapiens


Alignment Length:272 Identity:70/272 - (25%)
Similarity:108/272 - (39%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 SAPP-----------TAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDE---KQYECEECGKRLKH 344
            |.||           |..|...|.|.:|:|....|.:|..|:|.|..:   ..:.|..|||.|..
Human    44 SKPPGPNRIGRRNQETKEEKSSYNCPLCEKICTTQHQLTMHIRQHNTDTGGADHSCSICGKSLSS 108

  Fly   345 LRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKL 409
            ..:...|||.|:..:|::|::||:.:.|..::..|.:.| ||.|    ......|....|:|.:|
Human   109 ASSLDRHMLVHSGERPYKCTVCGQSFTTNGNMHRHMKIH-EKDP----NSATATAPPSPLKRRRL 168

  Fly   410 THTGERPYACDLCDKAYYDSSSLRQ-----HKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSG 469
              :.:|        |..:|:.|.|:     .|:...|:..        .|.:|:....|      
Human   169 --SSKR--------KLSHDAESEREDPAPAKKMVEDGQSG--------DLEKKADEVFH------ 209

  Fly   470 VKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVA 534
                 |.||...|.....|..|:..|| :.|.:|::|...|.|.:.|..|..:.:|:.|..|...
Human   210 -----CPVCFKEFVCKYGLETHMETHS-DNPLRCDICCVTFRTHRGLLRHNALVHKQLPRDAMGR 268

  Fly   535 VQSINPPSRQAG 546
            ....|.||..||
Human   269 PFIQNNPSIPAG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 42/172 (24%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
COG5048 <387..523 CDD:227381 30/140 (21%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
zf-H2C2_2 403..426 CDD:290200 5/22 (23%)
C2H2 Zn finger 419..439 CDD:275368 5/24 (21%)
C2H2 Zn finger 447..467 CDD:275368 3/19 (16%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
zf-H2C2_2 487..510 CDD:290200 7/22 (32%)
C2H2 Zn finger 503..523 CDD:275368 6/19 (32%)
RREB1NP_001003699.1 COG5048 <64..246 CDD:227381 54/216 (25%)
C2H2 Zn finger 68..88 CDD:275368 7/19 (37%)
C2H2 Zn finger 99..119 CDD:275368 8/19 (42%)
zf-H2C2_2 111..136 CDD:290200 8/24 (33%)
C2H2 Zn finger 127..147 CDD:275368 5/19 (26%)
C2H2 Zn finger 211..230 CDD:275368 5/18 (28%)
C2H2 Zn finger 237..253 CDD:275368 5/15 (33%)
C2H2 Zn finger 645..665 CDD:275368
C2H2 Zn finger 673..693 CDD:275368
zf-H2C2_2 685..709 CDD:290200
C2H2 Zn finger 701..719 CDD:275368
C2H2 Zn finger 755..775 CDD:275368
C2H2 Zn finger 792..814 CDD:275368
C2H2 Zn finger 1248..1268 CDD:275368
zf-H2C2_2 1260..1285 CDD:290200
C2H2 Zn finger 1276..1297 CDD:275368
TMEM119 <1467..1531 CDD:292352
C2H2 Zn finger 1569..1589 CDD:275368
zf-H2C2_2 1581..1605 CDD:290200
zf-C2H2 1595..1617 CDD:278523
C2H2 Zn finger 1597..1617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.