DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF250

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001350027.1 Gene:ZNF250 / 58500 HGNCID:13044 Length:560 Species:Homo sapiens


Alignment Length:332 Identity:114/332 - (34%)
Similarity:166/332 - (50%) Gaps:28/332 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 IKNEFETIVTEED------EFEVMNDSGAHD----AILDCQMIVIPAE--GAIDEVIGEETLELE 266
            :|.:..|..|::|      |.|...:|...|    .::..|.:::...  |.||:         |
Human   102 LKYDHTTACTQQDSLSCPWECETKGESQNTDLSPKPLISEQTVILGKTPLGRIDQ---------E 157

  Fly   267 GDGREEH--LLPEAEDVCEDEDFLEESLDSAPPTA---GEALPYVCTVCQKAFRQQCRLNQHMRS 326
            .:..::.  |.|.:.|..|.: .|.:|:...|..|   ||. ||:|..|.|.|.:...|.||.|.
Human   158 NNETKQSFCLSPNSVDHREVQ-VLSQSMPLTPHQAVPSGER-PYMCVECGKCFGRSSHLLQHQRI 220

  Fly   327 HVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNC 391
            |..||.|.|..|||.........:|...||..||::|:.||:.:|.:|.||.|.:.|..:||:.|
Human   221 HTGEKPYVCSVCGKAFSQSSVLSKHRRIHTGEKPYECNECGKAFRVSSDLAQHHKIHTGEKPHEC 285

  Fly   392 DQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQ 456
            .:|.:.:....||.:|:..|||||||.|.||.||:..|:.||.|:..|||:|...|..||...|.
Human   286 LECRKAFTQLSHLIQHQRIHTGERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCNECGKTFSV 350

  Fly   457 KSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMR 521
            |....:|..:|:|.|.:.|..||.||:..|.|..|..:|:||||::|..|.|.|..:..|.:|.|
Human   351 KRTLLQHQRIHTGEKPYTCSECGKAFSDRSVLIQHHNVHTGEKPYECSECGKTFSHRSTLMNHER 415

  Fly   522 VHNKESP 528
            :|.:|.|
Human   416 IHTEEKP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 63/156 (40%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 56/135 (41%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 14/22 (64%)
C2H2 Zn finger 419..439 CDD:275368 9/19 (47%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..510 CDD:290200 10/22 (45%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
ZNF250NP_001350027.1 KRAB 22..82 CDD:214630
COG5048 178..537 CDD:227381 97/247 (39%)
C2H2 Zn finger 201..221 CDD:275368 8/19 (42%)
C2H2 Zn finger 229..249 CDD:275368 5/19 (26%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
C2H2 Zn finger 341..361 CDD:275368 6/19 (32%)
C2H2 Zn finger 369..389 CDD:275368 8/19 (42%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
C2H2 Zn finger 425..445 CDD:275368
C2H2 Zn finger 453..473 CDD:275368
C2H2 Zn finger 481..501 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.