Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093876.1 | Gene: | si:dkey-208k4.2 / 570186 | ZFINID: | ZDB-GENE-030131-6124 | Length: | 361 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 74/268 - (27%) |
---|---|---|---|
Similarity: | 107/268 - (39%) | Gaps: | 48/268 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 333 YEC--EECGKRLKHLRNYKEHMLTHTNVKPHQCSI--CGRFYRTTSSLAVHKRTHAEKKPYNCD- 392
Fly 393 -QCGRGYAAFDHLRRH-KLTHT-GERPYAC--DLCDKAYYDSSSLRQHKISHTGKKAFTC--EIC 450
Fly 451 GVGLSQKSGYKKHMMVHSGVKA--HKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTK 513
Fly 514 KRLASHMRVHNKESPVTATVAVQSINPPSRQAGAEGATGGGATGGSPTGGGATGGSATNL--HIT 576
Fly 577 EVHEQPVS 584 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 39/129 (30%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | |||
C2H2 Zn finger | 335..355 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/21 (33%) | ||
COG5048 | <387..523 | CDD:227381 | 41/145 (28%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 8/22 (36%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 8/26 (31%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 4/21 (19%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 9/19 (47%) | ||
si:dkey-208k4.2 | NP_001093876.1 | COG5048 | <18..168 | CDD:227381 | 43/150 (29%) |
C2H2 Zn finger | 19..37 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 45..67 | CDD:275368 | 7/21 (33%) | ||
C2H2 Zn finger | 75..95 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 110..129 | CDD:275368 | 5/18 (28%) | ||
C2H2 Zn finger | 136..158 | CDD:275368 | 4/21 (19%) | ||
C2H2 Zn finger | 166..185 | CDD:275368 | 4/21 (19%) | ||
C2H2 Zn finger | 191..211 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 220..240 | CDD:275368 | 7/45 (16%) | ||
C2H2 Zn finger | 251..270 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170584074 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |