Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104669.1 | Gene: | znf1068 / 569852 | ZFINID: | ZDB-GENE-080215-12 | Length: | 419 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 99/250 - (39%) |
---|---|---|---|
Similarity: | 135/250 - (54%) | Gaps: | 1/250 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
Fly 369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLR 433
Fly 434 QHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGE 498
Fly 499 KPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSI-NPPSRQAGAEGATG 552 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 63/146 (43%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 9/19 (47%) | ||
COG5048 | <387..523 | CDD:227381 | 53/135 (39%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 8/19 (42%) | ||
znf1068 | NP_001104669.1 | C2H2 Zn finger | 83..103 | CDD:275368 | |
zf-H2C2_2 | 95..118 | CDD:290200 | 4/9 (44%) | ||
COG5048 | 107..>411 | CDD:227381 | 98/249 (39%) | ||
C2H2 Zn finger | 111..131 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 123..148 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 139..159 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 151..176 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 167..187 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 179..202 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 195..215 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 207..230 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 223..243 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 235..260 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 251..271 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 279..299 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 291..316 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 319..344 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | |||
C2H2 Zn finger | 391..411 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |