Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_697406.4 | Gene: | LOC568955 / 568955 | -ID: | - | Length: | 541 | Species: | Danio rerio |
Alignment Length: | 430 | Identity: | 99/430 - (23%) |
---|---|---|---|
Similarity: | 144/430 - (33%) | Gaps: | 151/430 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 IKNEFETIVTEEDEFEVMNDSGAHDAILDC----QMIVIPAEGAIDEVIGEETLELEGDGREEHL 274
Fly 275 LPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECG 339
Fly 340 KRLKHLRNYKEHMLTHTNVKPHQCSIC-------GRFYR---------------------TTSSL 376
Fly 377 AVHKRTHAEKK------------------------------------------------------ 387
Fly 388 --------PYNCDQCGRGYAAFD------------------------------------------ 402
Fly 403 -HLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMV 466
Fly 467 HSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVC 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 56/286 (20%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/47 (15%) | ||
COG5048 | <387..523 | CDD:227381 | 49/225 (22%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 9/62 (15%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 12/20 (60%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 2/4 (50%) | ||
LOC568955 | XP_697406.4 | C2H2 Zn finger | 169..189 | CDD:275368 | 6/19 (32%) |
zf-H2C2_2 | 181..206 | CDD:290200 | 9/24 (38%) | ||
COG5048 | 193..>467 | CDD:227381 | 55/276 (20%) | ||
C2H2 Zn finger | 197..217 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 209..234 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 225..245 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 253..273 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 383..403 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 395..420 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 411..431 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 423..446 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 439..459 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 451..476 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 467..487 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 479..502 | CDD:290200 | 12/20 (60%) | ||
C2H2 Zn finger | 495..515 | CDD:275368 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170584076 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |