DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and Zfp773-ps1

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_017445439.1 Gene:Zfp773-ps1 / 502292 RGDID:1563793 Length:424 Species:Rattus norvegicus


Alignment Length:457 Identity:128/457 - (28%)
Similarity:194/457 - (42%) Gaps:80/457 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ESQTHSPNQSQQ-------HD-------QQQQAFDSTE----EYVMIEM--------LNEEQENV 142
            ::||....|..|       ||       ::.:..|.::    .:||:|:        |.....::
  Rat     7 QTQTAVAGQGAQAQGGVAFHDVAIYFLREEWRLLDDSQRRLYHHVMMEVFVLMSSSGLVPSGTDI 71

  Fly   143 ANLDEELAEEDRRIFAMTVDEEEEFLTEEVDQ-----DDELSEEEHQLAQSGDQQEEHITMESVH 202
            ..|:   :..||.|.|:      .|||..|:.     :..||..|..|         ::||....
  Rat    72 TQLE---SSGDRFIPAL------RFLTPRVEPAKIPCEQTLSTTERGL---------NVTMLPQQ 118

  Fly   203 EFQPAEVEYVTIKNEFETIVTEEDEFEVMNDS-GAHDAILDCQMIVIPAEGAIDEVIGEETLELE 266
            |...||....  :.|....||:.:..::...: .:.|..:|.:        .:..::|......:
  Rat   119 ELSSAENHLQ--RAEHRLSVTKRNRSDISEKTLQSTDNTMDSR--------TLSGLLGHHATHSD 173

  Fly   267 GDGREEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPY-VCTVCQKAFRQQCRLNQHMRSHVDE 330
            | |:                  ..|......|..|...| .|:.|.|:|..:..|.:|.|.|..|
  Rat   174 G-GQ------------------PRSTKKGKATHSEKRNYKCCSYCGKSFNCRSLLIRHRRIHTGE 219

  Fly   331 KQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCG 395
            |.::|.||.|......:..:|:..||..||.:||.||:.::.:.||..|:|.|..:|||.|:|||
  Rat   220 KPFKCSECEKSFIQKADLNQHLKVHTGEKPFRCSKCGKKFKHSRSLVGHQRLHTGEKPYKCNQCG 284

  Fly   396 RGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGY 460
            ..|.....|.||.|.||||:||.|..|.|.:.:.|||..|...|||::.|.|..|.....:.|..
  Rat   285 ESYVNRSSLIRHNLVHTGEKPYKCSECGKLFKEKSSLVYHARVHTGERPFECSQCKKSFKKNSHL 349

  Fly   461 KKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNK 525
            .||..|||..|..||:|||..||....|..|.|.|:.||..:|:.|.|.|..:..|:.|.:||.:
  Rat   350 VKHRKVHSRGKPFKCNVCGRFFTMRYILVKHQRFHTAEKHHECKECGKVFCYRTGLSRHRKVHAE 414

  Fly   526 ES 527
            ::
  Rat   415 KN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 61/154 (40%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 57/135 (42%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
zf-H2C2_2 403..426 CDD:290200 13/22 (59%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 5/19 (26%)
C2H2 Zn finger 475..495 CDD:275368 9/19 (47%)
zf-H2C2_2 487..510 CDD:290200 9/22 (41%)
C2H2 Zn finger 503..523 CDD:275368 6/19 (32%)
Zfp773-ps1XP_017445439.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.