| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005946.2 | Gene: | MTF1 / 4520 | HGNCID: | 7428 | Length: | 753 | Species: | Homo sapiens |
| Alignment Length: | 229 | Identity: | 77/229 - (33%) |
|---|---|---|---|
| Similarity: | 111/229 - (48%) | Gaps: | 36/229 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 332 QYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSI--CGRFYRTTSSLAVHKRTHAEKKPYNCDQ- 393
Fly 394 -CGRGYAAFDHLRRHKLTHTGERPYACDL--CDKAYYDSSSLRQHKISHTGKKAFTCEI--CGVG 453
Fly 454 LSQKSGYKKHMMVHSGVKAHKC--DVCGHAFTFTSNLNAHVRLHSGEKPFKC--EVCVKAFPTKK 514
Fly 515 RLASHMRVHNKESPVTATVAVQSINPPSRQAGAE 548 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 41/126 (33%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | |||
| C2H2 Zn finger | 335..355 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 7/21 (33%) | ||
| COG5048 | <387..523 | CDD:227381 | 56/145 (39%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 7/21 (33%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 6/21 (29%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 503..523 | CDD:275368 | 9/21 (43%) | ||
| MTF1 | NP_005946.2 | COG5048 | <93..291 | CDD:227381 | 63/180 (35%) |
| Nuclear localization signal. /evidence=ECO:0000255 | 133..138 | 0/19 (0%) | |||
| C2H2 Zn finger | 145..164 | CDD:275368 | 6/18 (33%) | ||
| zf-H2C2_2 | 156..183 | CDD:290200 | 8/26 (31%) | ||
| C2H2 Zn finger | 172..194 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 186..213 | CDD:290200 | 12/26 (46%) | ||
| C2H2 Zn finger | 202..224 | CDD:275368 | 7/21 (33%) | ||
| zf-C2H2_8 | 231..319 | CDD:292531 | 34/95 (36%) | ||
| C2H2 Zn finger | 234..253 | CDD:275368 | 4/18 (22%) | ||
| zf-H2C2_2 | 245..271 | CDD:290200 | 10/25 (40%) | ||
| C2H2 Zn finger | 261..283 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 275..302 | CDD:290200 | 13/26 (50%) | ||
| C2H2 Zn finger | 291..313 | CDD:275368 | 9/21 (43%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 308..328 | 6/27 (22%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 395..466 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 648..715 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||