| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001036004.1 | Gene: | MAZ / 4150 | HGNCID: | 6914 | Length: | 493 | Species: | Homo sapiens |
| Alignment Length: | 290 | Identity: | 80/290 - (27%) |
|---|---|---|---|
| Similarity: | 119/290 - (41%) | Gaps: | 74/290 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 304 PYVCTVCQKAFRQQCRLNQHMRSHVD--------------------------------------- 329
Fly 330 ----------------------EKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRT 372
Fly 373 TSSLAVHKRTH--AEKKPYNCDQCGRGYAAFDHLRRH-KLTHTGERPYACDLCDKAYYDSSSLRQ 434
Fly 435 HKISHTGKKAFTCEICGVGLSQKSGY-KKHMMVHSGVKAHKCDVCGHAFTFTSNLNAH-VRLHSG 497
Fly 498 EKP----FKCEVCVKAFPTKKRLASHMRVH 523 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 51/210 (24%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | <387..523 | CDD:227381 | 52/142 (37%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | 7/27 (26%) | ||
| C2H2 Zn finger | 503..523 | CDD:275368 | 7/19 (37%) | ||
| MAZ | NP_001036004.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 59..78 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 121..146 | ||||
| C2H2 Zn finger | 192..212 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 7/19 (37%) | ||
| SFP1 | <303..360 | CDD:227516 | 20/56 (36%) | ||
| C2H2 Zn finger | 309..329 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 339..357 | CDD:275368 | 7/17 (41%) | ||
| C2H2 Zn finger | 368..388 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 394..413 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 421..437 | CDD:275368 | 5/15 (33%) | ||
| C2H2 Zn finger | 454..474 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3265 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||