DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and CG11247

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster


Alignment Length:386 Identity:101/386 - (26%)
Similarity:168/386 - (43%) Gaps:93/386 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VTEEDEFEVMNDSGAHDAILDCQMIVIPAEGAIDEVIGEETLELEGDGREEHLLPEAEDVC---- 282
            |::||...::.|||          |.:.:..|..|.....||.::   |.:..|....|.|    
  Fly     8 VSKEDAVSLLTDSG----------ISLSSPPAARESSPGPTLAIK---RRKSSLASLRDACVDEE 59

  Fly   283 ---------EDEDFLEESLDSAPPTAGEALP---YVCTVCQKAFRQQCRLNQHMRSHVDEKQYEC 335
                     :|:|:::..|..: ...||.:.   :||:.|.|.|..:..|.:||..|.||:.::|
  Fly    60 EDDGGEQDSKDDDYVQPQLKKS-ARKGEPVKRKHHVCSQCSKEFGGKTDLQRHMLIHSDERPHKC 123

  Fly   336 EECGKRLKHLRNYKEHMLT-HTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYA 399
            ::|||..:...|.|.|:.| |.:.|...||.|.:.:.....|.:|.|.|:.:|||.||.|.:.:|
  Fly   124 KDCGKSYRQAVNLKNHITTAHEHRKQFVCSQCPKSFALKERLRLHMRLHSGEKPYPCDLCDKKFA 188

  Fly   400 AFDHLRRHKLTH--TGERPYACDLCDKAYYDSSSLR----------------------------- 433
            ....|::|.::|  |..:.:.|..|..::..:::||                             
  Fly   189 RGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICENQFANELALRA 253

  Fly   434 -----QHKIS-----------------------HTGKKAFTCEICGVGLSQKSGYKKHMMVHSGV 470
                 .||::                       ||..|...||:|....:|||.|..||.:|:|.
  Fly   254 HINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNTYFTQKSQYNVHMRMHTGE 318

  Fly   471 KAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVK--AFPTKKRLASHM-RVHNKESP 528
            :.::|.:|...|..:|.|..|:|.|:|||||:|::|..  ||.....|.:|| ::|.::.|
  Fly   319 RPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 52/216 (24%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 8/20 (40%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
COG5048 <387..523 CDD:227381 51/197 (26%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 6/24 (25%)
C2H2 Zn finger 419..439 CDD:275368 6/76 (8%)
C2H2 Zn finger 447..467 CDD:275368 9/19 (47%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
zf-H2C2_2 487..510 CDD:290200 11/24 (46%)
C2H2 Zn finger 503..523 CDD:275368 7/22 (32%)
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 43/158 (27%)
C2H2 Zn finger 95..115 CDD:275368 7/19 (37%)
zf-H2C2_2 107..132 CDD:290200 10/24 (42%)
C2H2 Zn finger 123..144 CDD:275368 8/20 (40%)
C2H2 Zn finger 152..172 CDD:275368 6/19 (32%)
zf-H2C2_2 165..189 CDD:290200 10/23 (43%)
C2H2 Zn finger 180..200 CDD:275368 6/19 (32%)
COG5048 <192..369 CDD:227381 42/176 (24%)
C2H2 Zn finger 210..230 CDD:275370 4/19 (21%)
C2H2 Zn finger 238..260 CDD:275371 0/21 (0%)
C2H2 Zn finger 267..287 CDD:275368 0/19 (0%)
C2H2 Zn finger 295..315 CDD:275368 9/19 (47%)
zf-H2C2_2 309..332 CDD:290200 7/22 (32%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 351..374 CDD:275368 7/22 (32%)
C2H2 Zn finger 382..399 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.