DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dwg and snai2

DIOPT Version :9

Sequence 1:	NP_477338.3	Gene:	dwg / 31265	FlyBaseID:	FBgn0000520	Length:	592	Species:	Drosophila melanogaster
Sequence 2:	NP_989424.1	Gene:	snai2 / 395065	XenbaseID:	XB-GENE-487371	Length:	266	Species:	Xenopus tropicalis

Alignment Length:	133	Identity:	47/133 - (35%)
Similarity:	71/133 - (53%)	Gaps:	5/133 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   362 QCSICGRFYRTTSSLAVHKRTHAE---KKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCD 423
            |||:|.:.|.|.|.||.||:.|.:   :|.::|..|.:.|.:...|:.|..|||  .|..|.:|.
Frog   127 QCSLCSKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHT--LPCVCKICG 189

  Fly   424 KAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNL 488
            ||:.....|:.|..:|||:|.|:|..|....:.:|..:.|:..||.||.::|..|...|:..|.|
Frog   190 KAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLL 254

  Fly   489 NAH 491
            :.|
Frog   255 HKH 257

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dwg	NP_477338.3	zf-AD	14..91	CDD:214871
		COG5048	<297..451	CDD:227381	34/91 (37%)
		C2H2 Zn finger	307..327	CDD:275368
		C2H2 Zn finger	335..355	CDD:275368
		C2H2 Zn finger	363..383	CDD:275368	10/19 (53%)
		COG5048	<387..523	CDD:227381	35/105 (33%)
		C2H2 Zn finger	391..411	CDD:275368	5/19 (26%)
		zf-H2C2_2	403..426	CDD:290200	9/22 (41%)
		C2H2 Zn finger	419..439	CDD:275368	6/19 (32%)
		C2H2 Zn finger	447..467	CDD:275368	4/19 (21%)
		C2H2 Zn finger	475..495	CDD:275368	6/17 (35%)
		zf-H2C2_2	487..510	CDD:290200	2/5 (40%)
		C2H2 Zn finger	503..523	CDD:275368
snai2	NP_989424.1	DUF4764	82..>160	CDD:292583	13/32 (41%)
		C2H2 Zn finger	128..148	CDD:275370	10/19 (53%)
		C2H2 Zn finger	159..179	CDD:275368	5/19 (26%)
		C2H2 Zn finger	185..205	CDD:275368	6/19 (32%)
		zf-H2C2_2	198..221	CDD:290200	9/22 (41%)
		zf-C2H2	211..233	CDD:278523	5/21 (24%)
		C2H2 Zn finger	213..233	CDD:275368	4/19 (21%)
		zf-H2C2_2	225..250	CDD:290200	8/24 (33%)
		C2H2 Zn finger	241..257	CDD:275368	5/15 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910