DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF324B

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_997278.2 Gene:ZNF324B / 388569 HGNCID:33107 Length:544 Species:Homo sapiens


Alignment Length:264 Identity:101/264 - (38%)
Similarity:143/264 - (54%) Gaps:9/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 REEH-LLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQY 333
            :|.| ||...|....||  |.|:|.     |||. .:.|..|.|.|.:...|.:|:|:|..|:.|
Human   229 QEPHRLLGGQEPSTWDE--LGEALH-----AGEK-SFECRACSKVFVKSSDLLKHLRTHTGERPY 285

  Fly   334 ECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGY 398
            ||.:|||......:..:|...|:...|:.|.:||:.:|.:|||..|:|.|..:|.:.|.:||:.:
Human   286 ECTQCGKAFSQTSHLTQHQRIHSGETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCSECGKAF 350

  Fly   399 AAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKH 463
            :...:|.:|:..|.|.|||||..|.:.:..:|.|.||:.:|||:|.|.|.:||...||.|....|
Human   351 SHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFLH 415

  Fly   464 MMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528
            ..||:|.|...|..||.:|:.:|||..|..||:||:||:|..|.|.|.....|.||.|:|..|.|
Human   416 QRVHTGEKPFACAQCGRSFSRSSNLTQHQLLHTGERPFRCVDCGKGFAKGAVLLSHRRIHTGEKP 480

  Fly   529 VTAT 532
            ...|
Human   481 FVCT 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 55/153 (36%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 9/19 (47%)
COG5048 <387..523 CDD:227381 56/135 (41%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 7/19 (37%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..510 CDD:290200 12/22 (55%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
ZNF324BNP_997278.2 KRAB 1..61 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..222
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
COG5048 <268..499 CDD:227381 84/217 (39%)
C2H2 Zn finger 287..307 CDD:275368 5/19 (26%)
C2H2 Zn finger 315..335 CDD:275368 9/19 (47%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 399..419 CDD:275368 7/19 (37%)
C2H2 Zn finger 427..447 CDD:275368 8/19 (42%)
C2H2 Zn finger 455..475 CDD:275368 8/19 (42%)
C2H2 Zn finger 483..503 CDD:275368 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..544
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.