Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997278.2 | Gene: | ZNF324B / 388569 | HGNCID: | 33107 | Length: | 544 | Species: | Homo sapiens |
Alignment Length: | 264 | Identity: | 101/264 - (38%) |
---|---|---|---|
Similarity: | 143/264 - (54%) | Gaps: | 9/264 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 REEH-LLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQY 333
Fly 334 ECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGY 398
Fly 399 AAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKH 463
Fly 464 MMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528
Fly 529 VTAT 532 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 55/153 (36%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 9/19 (47%) | ||
COG5048 | <387..523 | CDD:227381 | 56/135 (41%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 8/19 (42%) | ||
ZNF324B | NP_997278.2 | KRAB | 1..61 | CDD:214630 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 184..222 | ||||
C2H2 Zn finger | 259..279 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <268..499 | CDD:227381 | 84/217 (39%) | ||
C2H2 Zn finger | 287..307 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 315..335 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 343..363 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 371..391 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 427..447 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 455..475 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 483..503 | CDD:275368 | 1/2 (50%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 508..544 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149927 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |