DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dwg and CG10348

DIOPT Version :9

Sequence 1:	NP_477338.3	Gene:	dwg / 31265	FlyBaseID:	FBgn0000520	Length:	592	Species:	Drosophila melanogaster
Sequence 2:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster

Alignment Length:	99	Identity:	33/99 - (33%)
Similarity:	57/99 - (57%)	Gaps:	3/99 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   442 KKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVR-LHSGEKPFKCEV 505
            |..:||:.||....:.:...:|:..|:|.:.:||..|..:|:.:|||..||| :|:.|:|||||:
  Fly   308 KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEI 372

  Fly   506 CVKAFPTKKRLASHMRVHNKESPVTATVAVQSIN 539
            |.:.|..:..|..|::.|  ||...:..|:..::
  Fly   373 CERCFGQQTNLDRHLKKH--ESDAVSLSALSGVS 404

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dwg	NP_477338.3	zf-AD	14..91	CDD:214871
		COG5048	<297..451	CDD:227381	3/8 (38%)
		C2H2 Zn finger	307..327	CDD:275368
		C2H2 Zn finger	335..355	CDD:275368
		C2H2 Zn finger	363..383	CDD:275368
		COG5048	<387..523	CDD:227381	29/81 (36%)
		C2H2 Zn finger	391..411	CDD:275368
		zf-H2C2_2	403..426	CDD:290200
		C2H2 Zn finger	419..439	CDD:275368
		C2H2 Zn finger	447..467	CDD:275368	4/19 (21%)
		C2H2 Zn finger	475..495	CDD:275368	9/20 (45%)
		zf-H2C2_2	487..510	CDD:290200	13/23 (57%)
		C2H2 Zn finger	503..523	CDD:275368	6/19 (32%)
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	18/54 (33%)
		zf-C2H2	311..333	CDD:278523	5/21 (24%)
		C2H2 Zn finger	313..333	CDD:275368	4/19 (21%)
		zf-H2C2_2	325..349	CDD:290200	6/23 (26%)
		C2H2 Zn finger	341..362	CDD:275368	9/20 (45%)
		zf-H2C2_2	353..377	CDD:290200	13/23 (57%)
		zf-C2H2	368..390	CDD:278523	8/21 (38%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910