DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF678

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_848644.2 Gene:ZNF678 / 339500 HGNCID:28652 Length:580 Species:Homo sapiens


Alignment Length:225 Identity:96/225 - (42%)
Similarity:133/225 - (59%) Gaps:0/225 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
            ||.|..|.|||.:...|.||.|.|..||.|:|||||.......:...|...||..||::|..||:
Human   291 PYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEECGNVFNECSHLTRHRRIHTGEKPYKCEECGK 355

  Fly   369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLR 433
            .:...:||..|||.|..:|||.|::||:.:....||..||..||||:||.|:.|.:.:...|:|.
Human   356 AFTQFASLTRHKRIHTGEKPYQCEECGKTFNRCSHLSSHKRIHTGEKPYKCEECGRTFTQFSNLT 420

  Fly   434 QHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGE 498
            |||..|||:|.:.|:.||...::.|...:|..:|:|||.:||:.||..|...|:|.:|.|:|:||
Human   421 QHKRIHTGEKPYKCKECGKAFNKFSSLTQHRRIHTGVKPYKCEECGKVFKQCSHLTSHKRIHTGE 485

  Fly   499 KPFKCEVCVKAFPTKKRLASHMRVHNKESP 528
            ||:||:.|.|||.....|:.|.|:|.:|.|
Human   486 KPYKCKECGKAFYQSSILSKHKRIHTEEKP 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 62/146 (42%)
C2H2 Zn finger 307..327 CDD:275368 9/19 (47%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 59/135 (44%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 12/22 (55%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 5/19 (26%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..510 CDD:290200 12/22 (55%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
ZNF678NP_848644.2 KRAB 44..101 CDD:214630
KRAB 44..83 CDD:279668
COG5048 138..536 CDD:227381 96/225 (43%)
C2H2 Zn finger 154..174 CDD:275368
zf-H2C2_2 167..191 CDD:290200
C2H2 Zn finger 182..202 CDD:275368
zf-H2C2_2 194..218 CDD:290200
C2H2 Zn finger 210..230 CDD:275368
zf-H2C2_2 223..246 CDD:290200
C2H2 Zn finger 238..258 CDD:275368
zf-H2C2_2 251..275 CDD:290200
C2H2 Zn finger 266..286 CDD:275368
zf-H2C2_2 278..302 CDD:290200 6/10 (60%)
C2H2 Zn finger 294..314 CDD:275368 9/19 (47%)
zf-H2C2_2 306..330 CDD:290200 13/23 (57%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
zf-H2C2_2 334..359 CDD:290200 8/24 (33%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
zf-H2C2_2 362..387 CDD:290200 12/24 (50%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
zf-H2C2_2 390..415 CDD:290200 12/24 (50%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
zf-H2C2_2 418..442 CDD:290200 11/23 (48%)
C2H2 Zn finger 434..454 CDD:275368 5/19 (26%)
zf-H2C2_2 446..471 CDD:290200 10/24 (42%)
C2H2 Zn finger 462..482 CDD:275368 8/19 (42%)
zf-H2C2_2 474..497 CDD:290200 12/22 (55%)
C2H2 Zn finger 490..510 CDD:275368 8/19 (42%)
zf-H2C2_2 503..527 CDD:290200 6/13 (46%)
C2H2 Zn finger 518..538 CDD:275368
zf-H2C2_2 530..553 CDD:290200
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.