DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF789

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_998768.2 Gene:ZNF789 / 285989 HGNCID:27801 Length:425 Species:Homo sapiens


Alignment Length:226 Identity:79/226 - (34%)
Similarity:116/226 - (51%) Gaps:0/226 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 KAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSL 376
            |.|.|:..|..|.|.....|.|||.||||.::....:.:|...|....|.:|.:||:.:|..|:|
Human   180 KPFNQRSLLLGHERILTRAKSYECSECGKVIRRKAWFDQHQRIHFLENPFECKVCGQAFRQRSAL 244

  Fly   377 AVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTG 441
            .|||:.|.:.|||.|..||:.:....:|..||..||.|:||.|..|:|.:..:|:|.:|::.|:|
Human   245 TVHKQCHLQNKPYRCHDCGKCFRQLAYLVEHKRIHTKEKPYKCSKCEKTFSQNSTLIRHQVIHSG 309

  Fly   442 KKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVC 506
            :|...|..||....:.|....|..:||....|||..||.:|....:|..|.|:|:.|:.|:|..|
Human   310 EKRHKCLECGKAFGRHSTLLCHQQIHSKPNTHKCSECGQSFGRNVDLIQHQRIHTKEEFFQCGEC 374

  Fly   507 VKAFPTKKRLASHMRVHNKESPVTATVAVQS 537
            .|.|..|:.|..|..:|....|....:..:|
Human   375 GKTFSFKRNLFRHQVIHTGSQPYQCVICGKS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 51/138 (37%)
C2H2 Zn finger 307..327 CDD:275368 6/14 (43%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 9/19 (47%)
COG5048 <387..523 CDD:227381 49/135 (36%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 11/22 (50%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 5/19 (26%)
C2H2 Zn finger 475..495 CDD:275368 7/19 (37%)
zf-H2C2_2 487..510 CDD:290200 9/22 (41%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
ZNF789NP_998768.2 KRAB 11..71 CDD:214630
KRAB 11..50 CDD:279668
COG5048 <179..303 CDD:227381 46/122 (38%)
C2H2 Zn finger 179..195 CDD:275368 6/14 (43%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..251 CDD:275368 9/19 (47%)
C2H2 Zn finger 259..279 CDD:275368 6/19 (32%)
zf-H2C2_2 271..296 CDD:290200 11/24 (46%)
COG5048 <283..420 CDD:227381 40/123 (33%)
C2H2 Zn finger 287..307 CDD:275368 6/19 (32%)
C2H2 Zn finger 315..335 CDD:275368 5/19 (26%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 399..419 CDD:275368 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.