DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and GFI1

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001120687.1 Gene:GFI1 / 2672 HGNCID:4237 Length:422 Species:Homo sapiens


Alignment Length:160 Identity:63/160 - (39%)
Similarity:94/160 - (58%) Gaps:1/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 HQCSICGRFYRTTSSLAVH-KRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDK 424
            ::|..|.:.:.|...|.|| :|:|:..:|:.|:.||:.:.....|.:||..|:.||.:.|.:|.|
Human   255 YKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGK 319

  Fly   425 AYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLN 489
            ::..||:|..|.:.|:..:.:.|:.||....|||..|||..:|:|.|.|||.|||.||:.:|||.
Human   320 SFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLI 384

  Fly   490 AHVRLHSGEKPFKCEVCVKAFPTKKRLASH 519
            .|.|.|:|.|||.|::|.|.|..|..|..|
Human   385 THSRKHTGFKPFGCDLCGKGFQRKVDLRRH 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 27/90 (30%)
C2H2 Zn finger 307..327 CDD:275368
C2H2 Zn finger 335..355 CDD:275368
C2H2 Zn finger 363..383 CDD:275368 7/20 (35%)
COG5048 <387..523 CDD:227381 55/133 (41%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 9/19 (47%)
C2H2 Zn finger 475..495 CDD:275368 11/19 (58%)
zf-H2C2_2 487..510 CDD:290200 12/22 (55%)
C2H2 Zn finger 503..523 CDD:275368 7/17 (41%)
GFI1NP_001120687.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109
SNAG domain. /evidence=ECO:0000250 1..20
Required for interaction with RELA. /evidence=ECO:0000269|PubMed:20547752 140..257 0/1 (0%)
COG5048 <254..416 CDD:227381 63/160 (39%)
C2H2 Zn finger 257..278 CDD:275368 7/20 (35%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..362 CDD:275368 9/19 (47%)
C2H2 Zn finger 370..390 CDD:275368 11/19 (58%)
C2H2 Zn finger 398..417 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.