DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and Zfp324

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_848847.3 Gene:Zfp324 / 243834 MGIID:2444641 Length:583 Species:Mus musculus


Alignment Length:284 Identity:105/284 - (36%)
Similarity:152/284 - (53%) Gaps:8/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 AIDEVIGEETLELEGDGREE--HLLPEAEDVCEDE--DFLEESLDSAPPTAGEALPYVCTVCQKA 313
            :|.::.|.|    ||.|..|  |......:|.|..  |.|.|:|.:.|.......|:.|..|.|.
Mouse   239 SIPDLHGAE----EGRGMSEAWHESQGDPNVTEARIWDELGEALQAGPGLLSGDKPFECRACNKV 299

  Fly   314 FRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAV 378
            |.:...|.:|:|:|..|:.|||.:|||......:..:|...|:...|:.|.:|.:.:|.:|||..
Mouse   300 FVKSSDLLKHLRTHTGERPYECAQCGKAFSQTSHLTQHQRIHSGETPYVCMVCSKAFRHSSSLVR 364

  Fly   379 HKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKK 443
            |:|.|..:|.::|::||:.::...:|.:|...|.|.|||||..|.:.:..:|.|.||:.:|||:|
Mouse   365 HQRIHTVEKSFHCNECGKAFSHGSNLSQHLKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEK 429

  Fly   444 AFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVK 508
            .:.|.:||...||.|...||..||:|.|...|..||.||:.:|||..|..||:||:||:|..|.|
Mouse   430 PYACSLCGAAFSQGSSLFKHQRVHTGEKPFSCPHCGRAFSHSSNLTQHQLLHTGERPFRCGDCGK 494

  Fly   509 AFPTKKRLASHMRVHNKESPVTAT 532
            ||.....|.||.|:|..|.|...|
Mouse   495 AFAKGAVLLSHRRIHTGEKPFVCT 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 51/153 (33%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 58/135 (43%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 8/19 (42%)
C2H2 Zn finger 475..495 CDD:275368 9/19 (47%)
zf-H2C2_2 487..510 CDD:290200 12/22 (55%)
C2H2 Zn finger 503..523 CDD:275368 9/19 (47%)
Zfp324NP_848847.3 KRAB 31..91 CDD:214630
KRAB 31..70 CDD:279668
zf-C2H2 291..313 CDD:278523 7/21 (33%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
COG5048 <297..497 CDD:227381 78/199 (39%)
zf-H2C2_2 305..330 CDD:290200 11/24 (46%)
C2H2 Zn finger 321..341 CDD:275368 5/19 (26%)
zf-H2C2_2 333..358 CDD:290200 5/24 (21%)
C2H2 Zn finger 349..369 CDD:275368 8/19 (42%)
zf-H2C2_2 361..386 CDD:290200 9/24 (38%)
C2H2 Zn finger 377..397 CDD:275368 5/19 (26%)
zf-C2H2 403..425 CDD:278523 8/21 (38%)
C2H2 Zn finger 405..425 CDD:275368 6/19 (32%)
zf-H2C2_2 417..442 CDD:290200 10/24 (42%)
C2H2 Zn finger 433..453 CDD:275368 8/19 (42%)
zf-H2C2_2 445..470 CDD:290200 11/24 (46%)
C2H2 Zn finger 461..481 CDD:275368 9/19 (47%)
zf-H2C2_2 473..497 CDD:290200 13/23 (57%)
C2H2 Zn finger 489..509 CDD:275368 9/19 (47%)
zf-H2C2_2 502..524 CDD:290200 8/17 (47%)
C2H2 Zn finger 517..537 CDD:275368 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.