DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and Zfp97

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_035895.3 Gene:Zfp97 / 22759 MGIID:105921 Length:546 Species:Mus musculus


Alignment Length:229 Identity:98/229 - (42%)
Similarity:131/229 - (57%) Gaps:1/229 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 GEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCS 364
            ||.| |.|..|.|||.....|..|.|:|..||.|||.:|||....|||.:.|..|||..||::|:
Mouse   262 GEKL-YQCNQCAKAFPYHRTLQIHERTHTGEKPYECNQCGKAFACLRNLQNHKTTHTGEKPYECN 325

  Fly   365 ICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDS 429
            .|||.:|....|..|:|.|..:||:.|:|||:.:|....|:|||.|||||:||.|:.|.||:...
Mouse   326 QCGRAFRQYVYLQCHERIHTREKPFECNQCGKAFAHHSTLQRHKRTHTGEKPYECNQCGKAFACP 390

  Fly   430 SSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRL 494
            ..|:.||.:|||:|.:.|..||...:....::.|...|:|.|.::|:.||.||.....|..|.|.
Mouse   391 RYLQIHKRTHTGEKPYECNQCGKAFACYQSFQIHKRTHTGEKPYECNQCGKAFACNRYLQIHKRT 455

  Fly   495 HSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528
            |:||:|::|..|.|||..:..|..|.|.|..|.|
Mouse   456 HTGERPYECNQCGKAFTCRSNLQIHKRTHTGEKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 69/150 (46%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 56/135 (41%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
zf-H2C2_2 403..426 CDD:290200 14/22 (64%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 4/19 (21%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..510 CDD:290200 10/22 (45%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
Zfp97NP_035895.3 KRAB 13..>54 CDD:214630
KRAB 13..52 CDD:279668
C2H2 Zn finger 133..152 CDD:275368
COG5048 156..541 CDD:227381 98/229 (43%)
C2H2 Zn finger 160..180 CDD:275368
zf-H2C2_2 172..197 CDD:290200
C2H2 Zn finger 188..208 CDD:275368
C2H2 Zn finger 216..232 CDD:275368
C2H2 Zn finger 241..260 CDD:275368
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
zf-H2C2_2 281..305 CDD:290200 12/23 (52%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
zf-H2C2_2 308..333 CDD:290200 11/24 (46%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 336..361 CDD:290200 10/24 (42%)
C2H2 Zn finger 352..372 CDD:275368 9/19 (47%)
zf-H2C2_2 365..389 CDD:290200 15/23 (65%)
C2H2 Zn finger 380..400 CDD:275368 7/19 (37%)
zf-H2C2_2 392..417 CDD:290200 10/24 (42%)
C2H2 Zn finger 408..428 CDD:275368 4/19 (21%)
zf-H2C2_2 420..445 CDD:290200 9/24 (38%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
zf-H2C2_2 448..473 CDD:290200 12/24 (50%)
C2H2 Zn finger 464..484 CDD:275368 8/19 (42%)
zf-H2C2_2 476..501 CDD:290200 6/14 (43%)
C2H2 Zn finger 492..512 CDD:275368
zf-H2C2_2 505..529 CDD:290200
C2H2 Zn finger 520..540 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11471
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.