Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001366288.1 | Gene: | Zfp54 / 22712 | MGIID: | 99201 | Length: | 625 | Species: | Mus musculus |
Alignment Length: | 231 | Identity: | 88/231 - (38%) |
---|---|---|---|
Similarity: | 126/231 - (54%) | Gaps: | 2/231 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 298 TAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQ 362
Fly 363 CSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYY 427
Fly 428 DSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHV 492
Fly 493 RLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 56/152 (37%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <387..523 | CDD:227381 | 54/135 (40%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 7/19 (37%) | ||
Zfp54 | NP_001366288.1 | KRAB | 52..92 | CDD:396083 | |
COG5048 | 138..544 | CDD:227381 | 80/211 (38%) | ||
C2H2 Zn finger | 225..245 | CDD:275368 | |||
C2H2 Zn finger | 253..273 | CDD:275368 | |||
C2H2 Zn finger | 285..305 | CDD:275368 | |||
C2H2 Zn finger | 313..333 | CDD:275368 | |||
C2H2 Zn finger | 341..361 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 397..417 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 425..445 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 453..473 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 481..501 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 509..529 | CDD:275368 | 9/19 (47%) | ||
SFP1 | <531..611 | CDD:227516 | 16/32 (50%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 565..585 | CDD:275368 | |||
C2H2 Zn finger | 593..613 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |