Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030098197.1 | Gene: | Zfp583 / 213011 | MGIID: | 2682297 | Length: | 608 | Species: | Mus musculus |
Alignment Length: | 267 | Identity: | 97/267 - (36%) |
---|---|---|---|
Similarity: | 147/267 - (55%) | Gaps: | 35/267 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
Fly 369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAY------- 426
Fly 427 -----------YD----------SSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGV 470
Fly 471 KAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAV 535
Fly 536 QSINPPS 542 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 63/174 (36%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <387..523 | CDD:227381 | 57/163 (35%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 11/47 (23%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 7/19 (37%) | ||
Zfp583 | XP_030098197.1 | KRAB | 45..106 | CDD:214630 | |
COG5048 | 240..581 | CDD:227381 | 90/246 (37%) | ||
C2H2 Zn finger | 253..273 | CDD:275368 | |||
C2H2 Zn finger | 281..301 | CDD:275368 | |||
C2H2 Zn finger | 309..329 | CDD:275368 | |||
C2H2 Zn finger | 337..357 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 365..385 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 393..413 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 421..441 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 449..469 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 477..497 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 505..525 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 533..553 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 561..581 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |