DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and Zfp583

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_030098197.1 Gene:Zfp583 / 213011 MGIID:2682297 Length:608 Species:Mus musculus


Alignment Length:267 Identity:97/267 - (36%)
Similarity:147/267 - (55%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
            ||.|..|:|||.|...|.||.|.|..|:.:||.||||...:.....:|...||..||:.|.:||:
Mouse   334 PYQCKECKKAFSQIAHLTQHQRIHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCHVCGK 398

  Fly   369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAY------- 426
            .:.....|.||:|.|..::||.|.:|.:.::.:.||.:|:..||||:||.|.:|.||:       
Mouse   399 AFSHRGYLIVHQRIHTGERPYECKECRKSFSQYAHLSQHQRVHTGEKPYECKVCRKAFSQVAYLD 463

  Fly   427 -----------YD----------SSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGV 470
                       |:          ||||.||:.||||:|.:.|:.|....||.:|..:|..:|:|.
Mouse   464 QHQRVHTGEKPYECAECRKAFSNSSSLAQHQRSHTGEKPYICKECRKTFSQNAGLAQHQRIHTGE 528

  Fly   471 KAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAV 535
            |.::|::||.||:::.:|..|.|:|:||:|::|:.|.|:|..:..||.|.:||..||       .
Mouse   529 KPYECNICGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHEKVHTMES-------F 586

  Fly   536 QSINPPS 542
            .|::.||
Mouse   587 LSLSSPS 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 63/174 (36%)
C2H2 Zn finger 307..327 CDD:275368 10/19 (53%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
COG5048 <387..523 CDD:227381 57/163 (35%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 403..426 CDD:290200 12/22 (55%)
C2H2 Zn finger 419..439 CDD:275368 11/47 (23%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..510 CDD:290200 10/22 (45%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
Zfp583XP_030098197.1 KRAB 45..106 CDD:214630
COG5048 240..581 CDD:227381 90/246 (37%)
C2H2 Zn finger 253..273 CDD:275368
C2H2 Zn finger 281..301 CDD:275368
C2H2 Zn finger 309..329 CDD:275368
C2H2 Zn finger 337..357 CDD:275368 10/19 (53%)
C2H2 Zn finger 365..385 CDD:275368 6/19 (32%)
C2H2 Zn finger 393..413 CDD:275368 7/19 (37%)
C2H2 Zn finger 421..441 CDD:275368 5/19 (26%)
C2H2 Zn finger 449..469 CDD:275368 4/19 (21%)
C2H2 Zn finger 477..497 CDD:275368 6/19 (32%)
C2H2 Zn finger 505..525 CDD:275368 6/19 (32%)
C2H2 Zn finger 533..553 CDD:275368 8/19 (42%)
C2H2 Zn finger 561..581 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.