| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510680.2 | Gene: | pat-9 / 181714 | WormBaseID: | WBGene00003933 | Length: | 470 | Species: | Caenorhabditis elegans |
| Alignment Length: | 207 | Identity: | 52/207 - (25%) |
|---|---|---|---|
| Similarity: | 75/207 - (36%) | Gaps: | 61/207 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 414 ERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVC 478
Fly 479 GHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVT------------A 531
Fly 532 TVAVQSINPPSRQAGAEGATGGGA----------TGGSPTGGGAT------GGSATNLHITEVH- 579
Fly 580 --EQPVSTSKVV 589 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 14/36 (39%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | |||
| C2H2 Zn finger | 335..355 | CDD:275368 | |||
| C2H2 Zn finger | 363..383 | CDD:275368 | |||
| COG5048 | <387..523 | CDD:227381 | 34/108 (31%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | |||
| zf-H2C2_2 | 403..426 | CDD:290200 | 6/11 (55%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 0/19 (0%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 503..523 | CDD:275368 | 7/19 (37%) | ||
| pat-9 | NP_510680.2 | C2H2 Zn finger | 86..106 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 98..123 | CDD:290200 | 12/52 (23%) | ||
| C2H2 Zn finger | 114..134 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 142..162 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C160166841 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||