DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and F58G1.2

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001254358.1 Gene:F58G1.2 / 174931 WormBaseID:WBGene00010264 Length:500 Species:Caenorhabditis elegans


Alignment Length:465 Identity:98/465 - (21%)
Similarity:158/465 - (33%) Gaps:140/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 EEVDQDDELSEEEHQLAQSGDQQEEHITMESVHEFQPAEVEYV-TIKNEFETIVTEEDEFEVMND 233
            |.||::|.|||::|  |:..|.|:|. ..:.:..|...:.:.: .|:..|.....:::.....||
 Worm     5 EIVDREDSLSEDDH--AEHRDCQDEK-EQQIIASFNAQDAQQIRRIQEHFLQECMKKETVAEAND 66

  Fly   234 SGAHDAILDCQMIVIPAEGAI------DEVIGEETLELEGDGREEHLL-----------PEAE-D 280
            ||.:|..  |....:...|.:      ...|.:|.:.|.||||....|           |.|| |
 Worm    67 SGRNDVC--CPRKKLTGVGELLASLRNPPKIHKERIILGGDGRPIKKLRENRAALNFIDPSAELD 129

  Fly   281 VC----EDEDFLEESLDSAPPT---------AGEALPYVCTVCQKAFRQQCRLNQHMR-SHVD-- 329
            .|    :.:||....|:..|.:         |.....:.|.||:..|.:...|.:|:| ||..  
 Worm   130 KCIVRQKQQDFCAPDLNMVPASSLSIDEIRNAVRKSMFRCKVCKNRFGEMSLLERHLRDSHPKAY 194

  Fly   330 ----EKQYECEECGKRLKHLRNYKEHMLTHTNVKPH----------------------------- 361
                |.|.|..:....|:..||..|.:::...:.|.                             
 Worm   195 IAFLENQREMADYMGELERERNRIEELVSGGFIPPESEIEATSNNLEVDSIPLPGENSQGHIPRL 259

  Fly   362 -------------------------QCSICGRFYRTTSSLAVH-KRTH----------------- 383
                                     ||..|.:.:|...|...| .:.|                 
 Worm   260 NRYGGLMYPMDALRKKFPYLKKRSPQCPFCDKRFRNDISFNNHLTKKHPECAEFVQCLHCFKCLP 324

  Fly   384 --AEKKPYNCD-------------QCGRGYAAFDHLRR-HKLTHTGERPYACDLCDKAYYDSSSL 432
              |:...::||             .| .||..|.|..: |:..|:|   :.|..|::.:.....|
 Worm   325 SAADLPTHDCDLTYLCLDCRPIRNMC-NGYRLFRHRTKFHRGYHSG---FRCPDCNQKFLTPRKL 385

  Fly   433 RQH-KISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHS 496
            |:| |::|...:.|.|..|.......:....|..||:|:...:|.||....:....:..|.:.|.
 Worm   386 RKHRKMAHVFSRTFQCHFCEEFFISDTAVTIHERVHTGILKFECTVCDFRASRYLQMEEHTKEHH 450

  Fly   497 GEKPFKCEVC 506
            |   :.|.||
 Worm   451 G---YMCSVC 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 45/258 (17%)
C2H2 Zn finger 307..327 CDD:275368 7/20 (35%)
C2H2 Zn finger 335..355 CDD:275368 4/19 (21%)
C2H2 Zn finger 363..383 CDD:275368 5/20 (25%)
COG5048 <387..523 CDD:227381 33/135 (24%)
C2H2 Zn finger 391..411 CDD:275368 8/33 (24%)
zf-H2C2_2 403..426 CDD:290200 6/23 (26%)
C2H2 Zn finger 419..439 CDD:275368 6/20 (30%)
C2H2 Zn finger 447..467 CDD:275368 3/19 (16%)
C2H2 Zn finger 475..495 CDD:275368 4/19 (21%)
zf-H2C2_2 487..510 CDD:290200 6/20 (30%)
C2H2 Zn finger 503..523 CDD:275368 3/4 (75%)
F58G1.2NP_001254358.1 bZIP <186..222 CDD:304365 10/35 (29%)
C2H2 Zn finger 372..393 CDD:275368 6/20 (30%)
C2H2 Zn finger 401..421 CDD:275368 3/19 (16%)
C2H2 Zn finger 429..449 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.