| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_496545.1 | Gene: | lin-29 / 174830 | WormBaseID: | WBGene00003015 | Length: | 459 | Species: | Caenorhabditis elegans |
| Alignment Length: | 314 | Identity: | 85/314 - (27%) |
|---|---|---|---|
| Similarity: | 123/314 - (39%) | Gaps: | 67/314 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 301 EALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQY-ECEECGKRLKHLRNYKEHMLTHTNVKPHQCS 364
Fly 365 I--CGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAF-------DHLRRHKLT-HTGERPYAC 419
Fly 420 DLCDKAYYDSSSLRQHKISHTGK-KA--FTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHA 481
Fly 482 F---TFTSNLNAHVRLHSGEKPFKCEVCVKAF---------------PTKKR------------- 515
Fly 516 LASHMRVHNKESPVTATV-----AVQSINPPSRQAGAEGATGGGATGGSPTGGG 564 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 56/163 (34%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 11/19 (58%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 6/21 (29%) | ||
| COG5048 | <387..523 | CDD:227381 | 36/177 (20%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 8/27 (30%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 7/23 (30%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 3/22 (14%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | 2/22 (9%) | ||
| C2H2 Zn finger | 503..523 | CDD:275368 | 6/47 (13%) | ||
| lin-29 | NP_496545.1 | zf-C2H2 | 151..173 | CDD:278523 | 12/21 (57%) |
| C2H2 Zn finger | 153..173 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 165..191 | CDD:290200 | 11/25 (44%) | ||
| zf-C2H2_8 | 181..265 | CDD:292531 | 28/86 (33%) | ||
| C2H2 Zn finger | 182..202 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 182..202 | CDD:278523 | 6/19 (32%) | ||
| zf-H2C2_2 | 194..221 | CDD:290200 | 8/26 (31%) | ||
| C2H2 Zn finger | 210..232 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 224..248 | CDD:290200 | 9/26 (35%) | ||
| C2H2 Zn finger | 240..269 | CDD:275368 | 9/33 (27%) | ||
| zf-C2H2 | 269..291 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 271..291 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||