DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and row-1

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001122473.1 Gene:row-1 / 172928 WormBaseID:WBGene00009508 Length:584 Species:Caenorhabditis elegans


Alignment Length:245 Identity:56/245 - (22%)
Similarity:86/245 - (35%) Gaps:69/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 YVC----TVCQKAFRQQCRLNQHMRSHV---------------DEKQYECEECGKRLKHLRNYKE 350
            ::|    |.|.|.......:..|:.:||               |:..:.|        .|||...
 Worm   171 FMCSYNPTKCYKLCGSVVEVINHIWAHVIHDPPLPPIEKKESKDDGMFSC--------LLRNSDA 227

  Fly   351 HMLTHTNV----KPHQCSICGRFYRTTSSLAVH-KRTHAEKKPYN--CDQC----GRGYAAFDHL 404
            ..|...:.    :...|..|...:||.....:| .:.|.|:...:  |:.|    |...|...|:
 Worm   228 AQLAENSALSLKRLQTCQFCNAVFRTVHLKTIHVVKCHMEQDHLDTTCNICELDFGNSIALNTHM 292

  Fly   405 RRHKLTHTGERPYACDLCD-----KAYYDSSSLRQHKISHTGKKAFTCEIC--GVGLSQKSGYKK 462
            ::|   .:||.||.|..|.     :|::....:.:|.   ...:...|.||  ...|.......|
 Worm   293 KKH---ISGEAPYNCQKCKYRTSVRAFFYQHFIEKHS---NDSRTLLCPICLHHEDLRPNVRRSK 351

  Fly   463 HMMVHSGV---KAH------KCDVCGHAFTFTSNL-------NAHVRLHS 496
            |:.|...|   ::|      :|.||  |.||||.|       |.|..|:|
 Worm   352 HIFVREFVNHMRSHALGPQMRCHVC--ALTFTSRLLLEAHRTNDHTMLNS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 37/182 (20%)
C2H2 Zn finger 307..327 CDD:275368 5/23 (22%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 5/20 (25%)
COG5048 <387..523 CDD:227381 36/139 (26%)
C2H2 Zn finger 391..411 CDD:275368 6/23 (26%)
zf-H2C2_2 403..426 CDD:290200 8/27 (30%)
C2H2 Zn finger 419..439 CDD:275368 4/24 (17%)
C2H2 Zn finger 447..467 CDD:275368 6/21 (29%)
C2H2 Zn finger 475..495 CDD:275368 11/26 (42%)
zf-H2C2_2 487..510 CDD:290200 5/17 (29%)
C2H2 Zn finger 503..523 CDD:275368
row-1NP_001122473.1 GAT1 <15..288 CDD:227928 23/124 (19%)
C2H2 Zn finger 244..265 CDD:275368 5/20 (25%)
C2H2 Zn finger 275..295 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.