DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and blmp-1

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001251370.1 Gene:blmp-1 / 172917 WormBaseID:WBGene00003847 Length:817 Species:Caenorhabditis elegans


Alignment Length:366 Identity:99/366 - (27%)
Similarity:138/366 - (37%) Gaps:94/366 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 HLLPEAEDVCEDEDFLEESLDSAPPTAGEALP------------YVCTVCQKAFRQQCRLNQHMR 325
            |.||          |:..|..|...::...:|            |.|..|.|.|.|...|..|:|
 Worm   474 HQLP----------FVNHSSSSHNDSSFNGVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVR 528

  Fly   326 SHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYN 390
            :|..|:.::||.|.|....|.:.::|.|.||..:||:|.||.:.:.:||:|..|.|.|..:|||.
 Worm   529 THTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYT 593

  Fly   391 CDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTC-------- 447
            ||.|...:..:.|||.||..|..||||:|..|.|.|...|.||.|      .|..||        
 Worm   594 CDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTH------WKTTTCKEEDMKDS 652

  Fly   448 ------EICG---VGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVR--------LH 495
                  :|.|   .|....|||                  |:...|.:.||:.::        ::
 Worm   653 MRDDLMDIKGEIDEGSMSGSGY------------------GNLGIFENTLNSELKRPLMPIETIY 699

  Fly   496 S----------GEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSINPPSR--QAGAE 548
            |          |:.|...:. .:|.|...:...||...|....:.....:|...||.:  |....
 Worm   700 SKYNLPNASLLGQGPSGMQE-QQAPPPTSQQQQHMMYGNTMGHMGQGSHLQGPPPPPQHFQMDHS 763

  Fly   549 GATGGGATGGSP-----TGGGATGGSATNLHITE--VHEQP 582
            |...|   ||.|     ..||.:.||....|...  :|..|
 Worm   764 GMQNG---GGIPHQHQLIQGGPSSGSGQQQHPQHNGIHRLP 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 60/179 (34%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
COG5048 <387..523 CDD:227381 44/170 (26%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 13/22 (59%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
C2H2 Zn finger 447..467 CDD:275368 7/36 (19%)
C2H2 Zn finger 475..495 CDD:275368 4/27 (15%)
zf-H2C2_2 487..510 CDD:290200 5/40 (13%)
C2H2 Zn finger 503..523 CDD:275368 4/19 (21%)
blmp-1NP_001251370.1 SET 119..247 CDD:214614
zf-C2H2 508..530 CDD:278523 9/21 (43%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
zf-H2C2_2 522..547 CDD:290200 9/24 (38%)
C2H2 Zn finger 538..558 CDD:275368 7/19 (37%)
zf-H2C2_2 550..575 CDD:290200 9/24 (38%)
C2H2 Zn finger 566..586 CDD:275368 8/19 (42%)
zf-H2C2_2 578..603 CDD:290200 10/24 (42%)
C2H2 Zn finger 594..614 CDD:275368 8/19 (42%)
zf-H2C2_2 606..631 CDD:290200 14/24 (58%)
ARS2 <620..772 CDD:282772 38/179 (21%)
C2H2 Zn finger 622..641 CDD:275368 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.