DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF497

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001193938.1 Gene:ZNF497 / 162968 HGNCID:23714 Length:498 Species:Homo sapiens


Alignment Length:225 Identity:96/225 - (42%)
Similarity:126/225 - (56%) Gaps:0/225 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
            |:.|..|.|:|.:...|.||.|:|..||.|||.||||......|:.||...||..:||.|..||:
Human   189 PFRCPDCGKSFGRSTTLVQHRRTHTGEKPYECPECGKAFSWNSNFLEHRRVHTGARPHACRDCGK 253

  Fly   369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLR 433
            .:..:|:||.|.:.||..:|:.|..||:.:.....||:|:.||:.|:|:.|..|.||:.:||.|.
Human   254 AFSQSSNLAEHLKIHAGARPHACPDCGKAFVRVAGLRQHRRTHSSEKPFPCAECGKAFRESSQLL 318

  Fly   434 QHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGE 498
            ||:.:|||::.|.|..||......|...:|..||:|.|.|.|..||.||:..|||.:|.|.|||.
Human   319 QHQRTHTGERPFECAECGQAFVMGSYLAEHRRVHTGEKPHACAQCGKAFSQRSNLLSHRRTHSGA 383

  Fly   499 KPFKCEVCVKAFPTKKRLASHMRVHNKESP 528
            |||.|..|.|||.....||.|...|..|.|
Human   384 KPFACADCGKAFRGSSGLAHHRLSHTGERP 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 60/146 (41%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
COG5048 <387..523 CDD:227381 58/135 (43%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 419..439 CDD:275368 9/19 (47%)
C2H2 Zn finger 447..467 CDD:275368 5/19 (26%)
C2H2 Zn finger 475..495 CDD:275368 10/19 (53%)
zf-H2C2_2 487..510 CDD:290200 13/22 (59%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
ZNF497NP_001193938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..104
COG5048 107..492 CDD:227381 96/225 (43%)
C2H2 Zn finger 108..128 CDD:275368
zf-H2C2_2 120..144 CDD:290200
C2H2 Zn finger 136..156 CDD:275368
zf-H2C2_2 148..171 CDD:290200
C2H2 Zn finger 164..184 CDD:275368
zf-C2H2 190..212 CDD:278523 8/21 (38%)
C2H2 Zn finger 192..212 CDD:275368 8/19 (42%)
zf-H2C2_2 205..228 CDD:290200 14/22 (64%)
C2H2 Zn finger 220..240 CDD:275368 8/19 (42%)
C2H2 Zn finger 248..268 CDD:275368 7/19 (37%)
C2H2 Zn finger 276..296 CDD:275368 6/19 (32%)
zf-H2C2_2 289..311 CDD:290200 10/21 (48%)
C2H2 Zn finger 304..324 CDD:275368 9/19 (47%)
zf-H2C2_2 317..340 CDD:290200 10/22 (45%)
C2H2 Zn finger 332..352 CDD:275368 5/19 (26%)
zf-H2C2_2 344..369 CDD:290200 11/24 (46%)
C2H2 Zn finger 360..380 CDD:275368 10/19 (53%)
C2H2 Zn finger 388..408 CDD:275368 8/19 (42%)
C2H2 Zn finger 416..436 CDD:275368
zf-H2C2_2 428..453 CDD:290200
C2H2 Zn finger 444..464 CDD:275368
zf-H2C2_2 456..481 CDD:290200
C2H2 Zn finger 472..492 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.