DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF582

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001307300.2 Gene:ZNF582 / 147948 HGNCID:26421 Length:517 Species:Homo sapiens


Alignment Length:408 Identity:127/408 - (31%)
Similarity:198/408 - (48%) Gaps:30/408 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EMLNEEQENVANLDEELAEEDRRIFAMTVDEEEEFLTEEV------------DQDDELSEEEHQL 185
            :::.|...|:.:|...:::.|  :.:.....:|.::.|.|            ....||..::|..
Human    33 DVMLETYSNLVSLGLAVSKPD--VISFLEQGKEPWMVERVVSGGLCPVLESRYDTKELFPKQHVY 95

  Fly   186 AQSGDQQEEHITMESVHEFQPAEVEYVTIKNEFETIVTEEDEFEVMNDSGAHDAILDCQMIVIPA 250
            .....|.|   .|||:..:   .:|..:.::::|.    .::|:  ...|..|.... |||:...
Human    96 EVESPQWE---IMESLTSY---GLECSSFQDDWEC----RNQFD--RQQGNPDRHFH-QMIIRHE 147

  Fly   251 EGAIDEVIGEETLELEGDGREEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFR 315
            |....:.....|...:...||:   |...:.|..:.:.:|.|.:.........||.|..|.|||:
Human   148 EMPTFDQHASLTFYQKIHTREK---PFGYNKCRKDFWQKELLINHQGIYTNEKPYKCKECGKAFK 209

  Fly   316 QQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHK 380
            ...||.||...|..:|.|||:||||......|:.:|...||..||::|..|.:.:..:|.|..|:
Human   210 YGSRLIQHENIHSGKKPYECKECGKAFNSGSNFIQHQRVHTGEKPYECKDCEKAFSRSSQLIEHQ 274

  Fly   381 RTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAF 445
            |||..:|||.|.:||:.:....||:.|...||||:||||..|.|.:...|.|.||:..|||:|.:
Human   275 RTHTGEKPYQCKECGKAFNRISHLKVHYRIHTGEKPYACKECGKTFSHRSQLIQHQTVHTGRKLY 339

  Fly   446 TCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAF 510
            .|:.||...:|.|...:|..:|:|.|.::|.|||.||..:|.|..|.|:|:||||::|:||.:||
Human   340 ECKECGKAFNQGSTLIRHQRIHTGEKPYECKVCGKAFRVSSQLKQHQRIHTGEKPYQCKVCGRAF 404

  Fly   511 PTKKRLASHMRVHNKESP 528
            .....|..|.|:|..|.|
Human   405 KRVSHLTVHYRIHTGEKP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 62/153 (41%)
C2H2 Zn finger 307..327 CDD:275368 9/19 (47%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
COG5048 <387..523 CDD:227381 59/135 (44%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 403..426 CDD:290200 13/22 (59%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 10/19 (53%)
zf-H2C2_2 487..510 CDD:290200 11/22 (50%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
ZNF582NP_001307300.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.