| Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_653232.3 | Gene: | ZNF513 / 130557 | HGNCID: | 26498 | Length: | 541 | Species: | Homo sapiens |
| Alignment Length: | 535 | Identity: | 112/535 - (20%) |
|---|---|---|---|
| Similarity: | 164/535 - (30%) | Gaps: | 235/535 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 236 AHDAILDCQMIVIPAEGAIDEVIG-----------------EETLELEGDGREEHLLPEAED--- 280
Fly 281 ------------VCED----------EDFLEE-----------------SLDSAP---------- 296
Fly 297 -PTAGEALP----YVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHT 356
Fly 357 NVKPHQCSICGRFYRTTSSLAVHKRTHA--------------------------EKK-------- 387
Fly 388 ----------------------------------------------PYNCDQCG----------- 395
Fly 396 --------------------------RGYAAF---------DHLRRHKLTHTGERPYACDLCDKA 425
Fly 426 YYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNA 490
Fly 491 HVRLHSGEKPFKCEVCVKAFPT-----KKRLASHMRVHNKESPVTATVAVQSINPPSRQAGAEGA 550
Fly 551 TGGGATGGSPTGGGA 565 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
| COG5048 | <297..451 | CDD:227381 | 57/283 (20%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | <387..523 | CDD:227381 | 50/240 (21%) | ||
| C2H2 Zn finger | 391..411 | CDD:275368 | 9/65 (14%) | ||
| zf-H2C2_2 | 403..426 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 419..439 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 475..495 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 487..510 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 503..523 | CDD:275368 | 7/24 (29%) | ||
| ZNF513 | NP_653232.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..118 | 19/110 (17%) | |
| C2H2 Zn finger | 152..172 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | 176..>228 | CDD:227381 | 16/51 (31%) | ||
| C2H2 Zn finger | 180..200 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 192..217 | CDD:316026 | 9/24 (38%) | ||
| C2H2 Zn finger | 208..228 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 362..382 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | <372..>450 | CDD:227381 | 27/77 (35%) | ||
| C2H2 Zn finger | 390..410 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | 414..>487 | CDD:227381 | 24/74 (32%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 446..466 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 474..493 | CDD:275368 | 7/23 (30%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 492..541 | 9/45 (20%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165149931 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||