DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and AgaP_AGAP010926

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_309767.4 Gene:AgaP_AGAP010926 / 1271025 VectorBaseID:AGAP010926 Length:443 Species:Anopheles gambiae


Alignment Length:368 Identity:86/368 - (23%)
Similarity:136/368 - (36%) Gaps:115/368 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 LEGDGREEHLLPEAEDVCEDEDFLEESL---DSAPPTAGEALPY------VCTVCQKAFRQQCRL 320
            |....|:..|.||.|::.:::..|..|:   .|.|.....||.:      ..::|:|.     .:
Mosquito    87 LNASSRDYTLTPEKEEIVDEDMPLNLSMKPSTSTPNARHAALTHSINIWSPASMCEKE-----TI 146

  Fly   321 NQHMRSHVD-------EKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCS-------ICGRFYR 371
            :...:|::|       ....:.:|......|..::..|   |   :|||..       ...|...
Mosquito   147 DGDNQSNIDIENDDDSSGDLQIDESFDSQHHHHHHHHH---H---QPHQHQERQDRQRETARILT 205

  Fly   372 TTSSLAVHKR------THAEKKPYNCDQCGRGYAAFDHLRRHK---------------------- 408
            ..:||.::.|      :.:.:..:|..:..:||  |.||::.:                      
Mosquito   206 EYNSLLLNGRQSGGGGSRSSQDYFNYSKISKGY--FTHLQQQQKNLEILRQNRTDLFVLNGGNDN 268

  Fly   409 --------------------------------LTHTGERP------------------YACDLCD 423
                                            ::|..||.                  :.|..|.
Mosquito   269 NNKEGVKNQNQTGHERSGGAGSKQNWDRKLFGISHPVERKIPFDDHASPPKKKMPGRLHQCKQCG 333

  Fly   424 KAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNL 488
            |.:..||:|..|.:.|:..:.:.|:.||....|||..|||..:|:|.|.|||.||..||:.:|||
Mosquito   334 KTFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCVVCLKAFSQSSNL 398

  Fly   489 NAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESPVTA 531
            ..|:|.|||.|||.|.:|.|||..|..|..|....:.| |.||
Mosquito   399 ITHMRKHSGYKPFSCGLCDKAFQRKVDLRRHREGQHNE-PATA 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 35/251 (14%)
C2H2 Zn finger 307..327 CDD:275368 2/19 (11%)
C2H2 Zn finger 335..355 CDD:275368 3/19 (16%)
C2H2 Zn finger 363..383 CDD:275368 4/32 (13%)
COG5048 <387..523 CDD:227381 55/207 (27%)
C2H2 Zn finger 391..411 CDD:275368 5/73 (7%)
zf-H2C2_2 403..426 CDD:290200 8/94 (9%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 9/19 (47%)
C2H2 Zn finger 475..495 CDD:275368 10/19 (53%)
zf-H2C2_2 487..510 CDD:290200 13/22 (59%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
AgaP_AGAP010926XP_309767.4 zf-C2H2 327..349 CDD:278523 7/21 (33%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
COG5048 337..>413 CDD:227381 35/75 (47%)
zf-H2C2_2 342..366 CDD:290200 6/23 (26%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 13/24 (54%)
C2H2 Zn finger 385..405 CDD:275368 10/19 (53%)
zf-H2C2_2 397..420 CDD:290200 13/22 (59%)
C2H2 Zn finger 413..430 CDD:275368 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.