DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dwg and ZNF816

DIOPT Version :9

Sequence 1:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001026835.1 Gene:ZNF816 / 125893 HGNCID:26995 Length:651 Species:Homo sapiens


Alignment Length:239 Identity:95/239 - (39%)
Similarity:126/239 - (52%) Gaps:0/239 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGR 368
            ||.|..|.|.|.::..|..|.|.|..||.|:|.||||..........|...||..||::|:.||:
Human   312 PYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHKAIHTGEKPYKCNECGK 376

  Fly   369 FYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLR 433
            .:...|||..|...|..:|||.|::|...|....||.||:..||||..|.|.:|||.:...|.|.
Human   377 TFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKCKVCDKVFRSDSYLA 441

  Fly   434 QHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAHKCDVCGHAFTFTSNLNAHVRLHSGE 498
            :|:..|||:|.:.|..||...|:||..:.|..:|:|.|.:.|:.||..|:...||..|.|||:||
Human   442 EHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTCNECGKVFSRRENLARHHRLHAGE 506

  Fly   499 KPFKCEVCVKAFPTKKRLASHMRVHNKESPVTATVAVQSINPPS 542
            ||:|||.|.|.|..:..|..|.|:|..|.|....|..::....|
Human   507 KPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCKVCDKAFRSDS 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dwgNP_477338.3 zf-AD 14..91 CDD:214871
COG5048 <297..451 CDD:227381 58/146 (40%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
COG5048 <387..523 CDD:227381 59/135 (44%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 13/22 (59%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
C2H2 Zn finger 447..467 CDD:275368 7/19 (37%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
zf-H2C2_2 487..510 CDD:290200 15/22 (68%)
C2H2 Zn finger 503..523 CDD:275368 8/19 (42%)
ZNF816NP_001026835.1 KRAB 24..64 CDD:307490
C2H2 Zn finger 232..251 CDD:275368
C2H2 Zn finger 259..279 CDD:275368
COG5048 283..650 CDD:227381 95/239 (40%)
C2H2 Zn finger 287..307 CDD:275368
C2H2 Zn finger 315..335 CDD:275368 7/19 (37%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 399..419 CDD:275368 7/19 (37%)
C2H2 Zn finger 427..447 CDD:275368 7/19 (37%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
C2H2 Zn finger 483..503 CDD:275368 8/19 (42%)
C2H2 Zn finger 511..531 CDD:275368 8/19 (42%)
C2H2 Zn finger 539..559 CDD:275368 2/12 (17%)
C2H2 Zn finger 567..587 CDD:275368
C2H2 Zn finger 595..615 CDD:275368
C2H2 Zn finger 623..643 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.