Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001371161.1 | Gene: | Zfp988 / 115489950 | MGIID: | 3651985 | Length: | 633 | Species: | Mus musculus |
Alignment Length: | 254 | Identity: | 100/254 - (39%) |
---|---|---|---|
Similarity: | 135/254 - (53%) | Gaps: | 30/254 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 304 PYVCTVCQKAFRQQCRLNQHMRSHVDEKQYECEECGK--------RLKHLR------NYK----- 349
Fly 350 ----------EHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHL 404
Fly 405 RRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSG 469
Fly 470 VKAHKCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 66/175 (38%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 11/48 (23%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <387..523 | CDD:227381 | 59/135 (44%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 7/19 (37%) | ||
Zfp988 | NP_001371161.1 | KRAB | 12..52 | CDD:396083 | |
C2H2 Zn finger | 186..206 | CDD:275368 | |||
C2H2 Zn finger | 218..234 | CDD:275368 | |||
COG5048 | 240..607 | CDD:227381 | 100/254 (39%) | ||
C2H2 Zn finger | 242..262 | CDD:275368 | |||
C2H2 Zn finger | 270..290 | CDD:275368 | |||
C2H2 Zn finger | 298..318 | CDD:275368 | |||
C2H2 Zn finger | 326..346 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 1/19 (5%) | ||
C2H2 Zn finger | 410..430 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 438..458 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 466..486 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 494..514 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 522..542 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 550..570 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 578..598 | CDD:275368 | |||
C2H2 Zn finger | 606..626 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |