Sequence 1: | NP_477338.3 | Gene: | dwg / 31265 | FlyBaseID: | FBgn0000520 | Length: | 592 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006539528.1 | Gene: | Mzf1 / 109889 | MGIID: | 107457 | Length: | 814 | Species: | Mus musculus |
Alignment Length: | 315 | Identity: | 94/315 - (29%) |
---|---|---|---|
Similarity: | 143/315 - (45%) | Gaps: | 57/315 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 REEHLL-------PEAEDVCED--EDFLEESL--DSAPPTAGEALPYVCTVCQKAFRQQCRLNQH 323
Fly 324 MRSHVD---------------------------------------------EKQYECEECGKRLK 343
Fly 344 HLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYAAFDHLRRHK 408
Fly 409 LTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHMMVHSGVKAH 473
Fly 474 KCDVCGHAFTFTSNLNAHVRLHSGEKPFKCEVCVKAFPTKKRLASHMRVHNKESP 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dwg | NP_477338.3 | zf-AD | 14..91 | CDD:214871 | |
COG5048 | <297..451 | CDD:227381 | 54/198 (27%) | ||
C2H2 Zn finger | 307..327 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | 8/19 (42%) | ||
COG5048 | <387..523 | CDD:227381 | 49/135 (36%) | ||
C2H2 Zn finger | 391..411 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 419..439 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 475..495 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 487..510 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 503..523 | CDD:275368 | 8/19 (42%) | ||
Mzf1 | XP_006539528.1 | SCAN | 121..232 | CDD:128708 | |
COG5048 | 416..807 | CDD:227381 | 94/315 (30%) | ||
C2H2 Zn finger | 438..458 | CDD:275368 | |||
C2H2 Zn finger | 466..486 | CDD:275368 | 4/10 (40%) | ||
C2H2 Zn finger | 494..514 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 522..542 | CDD:275370 | 10/19 (53%) | ||
C2H2 Zn finger | 567..587 | CDD:275368 | 0/19 (0%) | ||
C2H2 Zn finger | 595..615 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 623..643 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 651..671 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 679..699 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 707..727 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 735..755 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 763..783 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 791..811 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24384 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |